KEGG   Homo sapiens (human): 100130361Help
Entry
100130361         CDS       T01001                                 

Gene name
CXorf49, CXorf49B
Definition
(RefSeq) chromosome X open reading frame 49
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4641
Motif
Other DBs
NCBI-GeneID: 100130361
NCBI-ProteinID: NP_001138612
HGNC: 30891
Ensembl: ENSG00000215115
Vega: OTTHUMG00000022702
Pharos: A8MYA2(Tdark)
UniProt: A8MYA2
Position
Xq13.1
AA seq 514 aa AA seqDB search
MSSPDKVSVCGAGFDLEGGKKAGSRTASPGAPGAHSHGLDLGVPGSGDGKSESGFTDPEG
FSFESESELIEQGRVVLWGREGRPGTPVDDQGDVVDYSFYLADEPAAIVPPPSVQGHPFP
EGAAAEGSAENWADAEVGPSGRDVLGHSPGKWQQASAGRLHLCGPGPVRAWKNPERGSKS
RWSLRVDPQQPSAKGPTRLPTHDSDSADESSDLPLMKVGICRNEGSQAKPGSPKKRADTS
RQASFHCKESYLPVPGRFLTSAPRGLTPVAERPAVGELEDSPQKKMQSRAWGKVEVRPSC
SGAAAAGALPQGLSRRKMAGGKKSLGGASQLALGRGFPACGERLSAAPPEPATFPPFSGV
RPQGMSKKPQKPKHSSPGKKPAGRKTRESQAAAREDNDPNRDEVPRAQLPTHRPGLPRLS
VRRGEFSSSDPNIRAPQLPGTSEPSAYSPGGLVPRRHAPSGNQQPPVHPPRPERQQQPPG
AQGCPRCIWLQREIEDLTQQLAAMQFLTDKFQDL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccccgacaaggtgtccgtttgtggggccggtttcgacctggagggtggcaaa
aaggctggctcccgcacggccagccccggagccccaggggcccacagccacggcctcgat
ttgggggtgccgggcagcggcgatggcaagagcgagagcgggttcacagatccagagggc
ttcagcttcgagtctgagagcgaattgatagagcaaggaagggtggtgctctggggccgg
gaaggccggccaggcaccccggtggatgaccaaggggacgttgtggactactcattctac
ctggctgacgaaccagccgccatcgtgccgccgcccagcgtccagggacacccgttccca
gaaggtgccgctgccgaagggtcggctgagaattgggcagatgcggaggtcggtcccagt
gggagagacgtgctgggccacagccctggaaaatggcagcaggcctctgccggccgtctc
cacctctgcggtcctgggccagtgcgggcctggaagaacccggaaaggggctcgaagagc
agatggagcctccgcgtggatccccagcagccctctgcgaaaggccccaccaggctgcct
acccacgactctgattccgcagatgagagcagcgacttaccactgatgaaggtaggcatt
tgccgcaacgaaggaagccaggccaagcccggcagccccaagaagcgagcagacacatcc
agacaggcaagcttccactgcaaggagagttacctgcctgtgccgggccgtttcctgacc
tctgctccccgcggactcactccagtcgcagagaggccggctgtgggagagctggaggac
tctccccagaagaaaatgcagagcagggcctggggaaaggtggaggtcaggcccagctgc
tcaggagctgctgctgcaggggccctgccccagggcctttcgaggaggaagatggccggg
gggaagaagtccctagggggtgcctctcaactggccctggggagaggctttcctgcctgc
ggagagagactctcagccgctcccccggagccggccaccttcccgccattctctggtgtg
cggccacaggggatgtccaagaaaccccaaaagcctaagcacagcagccctgggaagaaa
ccagcagggaggaagaccagggagtcccaggctgcggccagagaagataatgacccaaat
agagatgaggtcccaagagcccaacttcccacccacaggccaggactgcctcgcctgtct
gtgcgtcgtggagaattcagcagtagcgaccccaacatcagagctccccaacttccggga
acttcagagccctcggcctacagcccgggaggcctcgtgcccagacgccatgcaccctcc
ggtaaccagcagccgcctgtccatcccccaagaccggaaaggcagcagcagcccccggga
gcccagggctgtcctcggtgcatctggctgcagagggaaattgaggaccttacacagcag
ctagcggccatgcagttcctcactgacaagttccaggacctttga

DBGET integrated database retrieval system