KEGG   Homo sapiens (human): 100131801
Entry
100131801         CDS       T01001                                 
Symbol
PET100, C19orf79, MC4DN12
Name
(RefSeq) PET100 cytochrome c oxidase chaperone
  KO
K18186  protein PET100, animal type
Organism
hsa  Homo sapiens (human)
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    100131801 (PET100)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    100131801 (PET100)
SSDB
Motif
Pfam: Pet100
Other DBs
NCBI-GeneID: 100131801
NCBI-ProteinID: NP_001164626
OMIM: 614770
HGNC: 40038
Ensembl: ENSG00000229833
Vega: OTTHUMG00000182394
Pharos: P0DJ07(Tdark)
UniProt: P0DJ07
Position
19:7629793..7631956
AA seq 73 aa
MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKLQEIEEFKERLRKR
REEKLLRDAQQNS
NT seq 222 nt   +upstreamnt  +downstreamnt
atgggggtgaagctggagatatttcggatgataatctacctcactttccctgtggctatg
ttctgggtttccaatcaggccgagtggtttgaggacgatgtcatacagcgcaagagggag
ctgtggccacctgagaagcttcaagagatagaggaattcaaagagaggttacggaagcgg
cgggaggagaagctccttcgcgacgcccagcagaactcctga

DBGET integrated database retrieval system