KEGG   Homo sapiens (human): 100133267
Entry
100133267         CDS       T01001                                 

Gene name
DEFB130B
Definition
(RefSeq) defensin beta 130B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Defensin_beta
Other DBs
NCBI-GeneID: 100133267
NCBI-ProteinID: NP_001182186
HGNC: 39814
Ensembl: ENSG00000233050
Vega: OTTHUMG00000158721
UniProt: P0DP74 P0DP73
Position
8p23.1
AA seq 79 aa
MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCC
RRWWILEPYPTPVPKGKSP
NT seq 240 nt   +upstreamnt  +downstreamnt
atgaaactccattcccttatttctgttctcctcctctttgtgactttaataccaaaagga
aagactggcgttattccaggacaaaaacagtgtattgctttgaaaggggtgtgcagagac
aaactatgcagcacactagatgataccattggtatatgtaatgaaggaaaaaaatgttgt
agaaggtggtggatacttgagccctatccaactccggttcccaaaggaaaatctccttag

DBGET integrated database retrieval system