KEGG   Homo sapiens (human): 100133941
Entry
100133941         CDS       T01001                                 

Symbol
CD24, CD24A
Name
(RefSeq) CD24 molecule
  KO
K06469  CD24 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100133941 (CD24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    100133941 (CD24)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    100133941 (CD24)
CD molecules [BR:hsa04090]
 Proteins
  100133941 (CD24)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  100133941 (CD24)
SSDB
Motif
Pfam: CD24 DUF1180
Other DBs
NCBI-GeneID: 100133941
NCBI-ProteinID: NP_001278666
OMIM: 600074
HGNC: 1645
Ensembl: ENSG00000272398
Vega: OTTHUMG00000188439
Pharos: P25063(Tbio)
UniProt: P25063
Position
6q21
AA seq 80 aa
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGG
ALQSTASLFVVSLSLLHLYS
NT seq 243 nt   +upstreamnt  +downstreamnt
atgggcagagcaatggtggccaggctcgggctggggctgctgctgctggcactgctccta
cccacgcagatttattccagtgaaacaacaactggaacttcaagtaactcctcccagagt
acttccaactctgggttggccccaaatccaactaatgccaccaccaaggcggctggtggt
gccctgcagtcaacagccagtctcttcgtggtctcactctctcttctgcatctctactct
taa

DBGET integrated database retrieval system