KEGG   Homo sapiens (human): 100137049Help
Entry
100137049         CDS       T01001                                 

Gene name
PLA2G4B, HsT16992, cPLA2-beta
Definition
(RefSeq) phospholipase A2 group IVB
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100137049 (PLA2G4B)
   00565 Ether lipid metabolism
    100137049 (PLA2G4B)
   00590 Arachidonic acid metabolism
    100137049 (PLA2G4B)
   00591 Linoleic acid metabolism
    100137049 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    100137049 (PLA2G4B)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100137049 (PLA2G4B)
   04010 MAPK signaling pathway
    100137049 (PLA2G4B)
   04370 VEGF signaling pathway
    100137049 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    100137049 (PLA2G4B)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    100137049 (PLA2G4B)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100137049 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    100137049 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    100137049 (PLA2G4B)
  Endocrine system
   04912 GnRH signaling pathway
    100137049 (PLA2G4B)
   04913 Ovarian Steroidogenesis
    100137049 (PLA2G4B)
   04921 Oxytocin signaling pathway
    100137049 (PLA2G4B)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100137049 (PLA2G4B)
  Nervous system
   04724 Glutamatergic synapse
    100137049 (PLA2G4B)
   04726 Serotonergic synapse
    100137049 (PLA2G4B)
   04730 Long-term depression
    100137049 (PLA2G4B)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100137049 (PLA2G4B)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100137049 (PLA2G4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100137049 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 100137049
NCBI-ProteinID: NP_001108105
OMIM: 606088
HGNC: 9036
Ensembl: ENSG00000243708
Vega: OTTHUMG00000156809
UniProt: P0C869
Position
15q15.1
AA seq 781 aa AA seqDB search
MAVAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEG
RLEVEFRLQSLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGP
QEASVGTGTFRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMR
VELKKEAGLRELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIM
ATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKNKLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGQLMKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTAGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQQLQLLGRFCQE
QGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVSDSFREYSAPGVRRTPEEA
AAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALRQAVQRRRQRRP
H
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcagaggtgtccaggacctgcctgctcacggttcgtgtcctgcaggcccat
cgcctaccctctaaggacctagtgaccccctctgactgctacgtgactctctggctgccc
acggcctgcagccacaggctccagacacgcacggtcaagaacagcagtagccctgtctgg
aaccagagctttcacttcaggatccacaggcagctcaagaatgtcatggaactgaaagtc
tttgaccaggacctggtgaccggagatgaccctgtgttgtcagtactgtttgatgcgggg
actctgcgggctggggagttccggcgcgagagcttctcactgagccctcagggtgagggg
cgcctggaagttgaatttcgcctgcagagtctggctgaccgtggcgagtggctcgtcagc
aatggcgttctggtggcccgggagctctcctgcttgcacgttcaactggaggagacagga
gaccagaagtcctcagagcacagagttcagcttgtggttcctgggtcctgtgagggtccg
caggaggcctctgtgggcactggcaccttccgcttccactgcccagcctgctgggagcag
gagctgagtattcgcctgcaggatgcccccgaggagcaactaaaggcgccactgagtgcc
ctgccctctggtcaagtggtgaggcttgtcttccccacgtcccaggagcccctgatgaga
gtggagctgaaaaaagaagcaggactgagggagctggccgtgcgactgggcttcgggccc
tgtgcagaggagcaggccttcctgagcaggaggaagcaggtggtggccgcggccttgagg
caggccctgcagctggacggagacctgcaggaggatgagatcccagtggtagctattatg
gccactggtggtgggatccgggcaatgacttccctgtatgggcagctggctggcctgaag
gagctgggcctcttggattgcgtctcctacatcaccggggcctcgggctccacctgggcc
ttggccaacctttatgaggacccagagtggtctcagaaggacctggcagggcccactgag
ttgctgaagacccaggtgaccaagaacaagctgggtgtgctggcccccagccagctgcag
cggtaccggcaggagctggccgagcgtgcccgcttgggctacccaagctgcttcaccaac
ctgtgggccctcatcaacgaggcgctgctgcatgatgagccccatgatcacaagctctca
gatcaacgggaggccctgagtcatggccagaaccctctgcccatctactgtgccctcaac
accaaagggcagagcctgaccacttttgaatttggggagtggtgcgagttctctccctac
gaggtcggcttccccaagtacggggccttcatcccctctgagctctttggctccgagttc
tttatggggcagctgatgaagaggcttcctgagtcccgcatctgcttcttagaaggtatc
tggagcaacctgtatgcagccaacctccaggacagcttatactgggcctcagagcccagc
cagttctgggaccgctgggtcaggaaccaggccaacctggacaaggagcaggtccccctt
ctgaagatagaagaaccaccctcaacagccggcaggatagctgagtttttcaccgatctt
ctgacgtggcgtccactggcccaggccacacataatttcctgcgtggcctccatttccac
aaagactactttcagcatcctcacttctccacatggaaagctaccactctggatgggctc
cccaaccagctgacaccctcggagccccacctgtgcctgctggatgttggctacctcatc
aataccagctgcctgcccctcctgcagcccactcgggacgtggacctcatcctgtcattg
gactacaacctccacggagccttccagcagttgcagctcctgggccggttctgccaggag
caggggatcccgttcccacccatctcgcccagccccgaagagcagctccagcctcgggag
tgccacaccttctccgaccccacctgccccggagcccctgcggtgctgcactttcctctg
gtcagcgactccttccgggagtactcggcccctggggtccggcggacacccgaggaggcg
gcagctggggaggtgaacctgtcttcatcggactctccctaccactacacgaaggtgacc
tacagccaggaggacgtggacaagctgctgcacctgacacattacaatgtctgcaacaac
caggagcagctgctggaggctctgcgccaggcagtgcagcggaggcggcagcgcaggccc
cactga

DBGET integrated database retrieval system