KEGG   Homo sapiens (human): 100137049Help
Entry
100137049         CDS       T01001                                 

Gene name
PLA2G4B, HsT16992, cPLA2-beta
Definition
(RefSeq) phospholipase A2 group IVB
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100137049 (PLA2G4B)
   00565 Ether lipid metabolism
    100137049 (PLA2G4B)
   00590 Arachidonic acid metabolism
    100137049 (PLA2G4B)
   00591 Linoleic acid metabolism
    100137049 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    100137049 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100137049 (PLA2G4B)
   04010 MAPK signaling pathway
    100137049 (PLA2G4B)
   04370 VEGF signaling pathway
    100137049 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    100137049 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100137049 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100137049 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    100137049 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    100137049 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100137049 (PLA2G4B)
   04913 Ovarian Steroidogenesis
    100137049 (PLA2G4B)
   04921 Oxytocin signaling pathway
    100137049 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100137049 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    100137049 (PLA2G4B)
   04726 Serotonergic synapse
    100137049 (PLA2G4B)
   04730 Long-term depression
    100137049 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100137049 (PLA2G4B)
 09160 Human Diseases
  09161 Cancers
   05231 Choline metabolism in cancer
    100137049 (PLA2G4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100137049 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 100137049
NCBI-ProteinID: NP_001108105
OMIM: 606088
HGNC: 9036
Ensembl: ENSG00000243708
Vega: OTTHUMG00000156809
UniProt: P0C869
Position
15q15.1
AA seq 781 aa AA seqDB search
MAVAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEG
RLEVEFRLQSLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGP
QEASVGTGTFRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMR
VELKKEAGLRELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIM
ATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKNKLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGQLMKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTAGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQQLQLLGRFCQE
QGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVSDSFREYSAPGVRRTPEEA
AAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALRQAVQRRRQRRP
H
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcagaggtgtccaggacctgcctgctcacggttcgtgtcctgcaggcccat
cgcctaccctctaaggacctagtgaccccctctgactgctacgtgactctctggctgccc
acggcctgcagccacaggctccagacacgcacggtcaagaacagcagtagccctgtctgg
aaccagagctttcacttcaggatccacaggcagctcaagaatgtcatggaactgaaagtc
tttgaccaggacctggtgaccggagatgaccctgtgttgtcagtactgtttgatgcgggg
actctgcgggctggggagttccggcgcgagagcttctcactgagccctcagggtgagggg
cgcctggaagttgaatttcgcctgcagagtctggctgaccgtggcgagtggctcgtcagc
aatggcgttctggtggcccgggagctctcctgcttgcacgttcaactggaggagacagga
gaccagaagtcctcagagcacagagttcagcttgtggttcctgggtcctgtgagggtccg
caggaggcctctgtgggcactggcaccttccgcttccactgcccagcctgctgggagcag
gagctgagtattcgcctgcaggatgcccccgaggagcaactaaaggcgccactgagtgcc
ctgccctctggtcaagtggtgaggcttgtcttccccacgtcccaggagcccctgatgaga
gtggagctgaaaaaagaagcaggactgagggagctggccgtgcgactgggcttcgggccc
tgtgcagaggagcaggccttcctgagcaggaggaagcaggtggtggccgcggccttgagg
caggccctgcagctggacggagacctgcaggaggatgagatcccagtggtagctattatg
gccactggtggtgggatccgggcaatgacttccctgtatgggcagctggctggcctgaag
gagctgggcctcttggattgcgtctcctacatcaccggggcctcgggctccacctgggcc
ttggccaacctttatgaggacccagagtggtctcagaaggacctggcagggcccactgag
ttgctgaagacccaggtgaccaagaacaagctgggtgtgctggcccccagccagctgcag
cggtaccggcaggagctggccgagcgtgcccgcttgggctacccaagctgcttcaccaac
ctgtgggccctcatcaacgaggcgctgctgcatgatgagccccatgatcacaagctctca
gatcaacgggaggccctgagtcatggccagaaccctctgcccatctactgtgccctcaac
accaaagggcagagcctgaccacttttgaatttggggagtggtgcgagttctctccctac
gaggtcggcttccccaagtacggggccttcatcccctctgagctctttggctccgagttc
tttatggggcagctgatgaagaggcttcctgagtcccgcatctgcttcttagaaggtatc
tggagcaacctgtatgcagccaacctccaggacagcttatactgggcctcagagcccagc
cagttctgggaccgctgggtcaggaaccaggccaacctggacaaggagcaggtccccctt
ctgaagatagaagaaccaccctcaacagccggcaggatagctgagtttttcaccgatctt
ctgacgtggcgtccactggcccaggccacacataatttcctgcgtggcctccatttccac
aaagactactttcagcatcctcacttctccacatggaaagctaccactctggatgggctc
cccaaccagctgacaccctcggagccccacctgtgcctgctggatgttggctacctcatc
aataccagctgcctgcccctcctgcagcccactcgggacgtggacctcatcctgtcattg
gactacaacctccacggagccttccagcagttgcagctcctgggccggttctgccaggag
caggggatcccgttcccacccatctcgcccagccccgaagagcagctccagcctcgggag
tgccacaccttctccgaccccacctgccccggagcccctgcggtgctgcactttcctctg
gtcagcgactccttccgggagtactcggcccctggggtccggcggacacccgaggaggcg
gcagctggggaggtgaacctgtcttcatcggactctccctaccactacacgaaggtgacc
tacagccaggaggacgtggacaagctgctgcacctgacacattacaatgtctgcaacaac
caggagcagctgctggaggctctgcgccaggcagtgcagcggaggcggcagcgcaggccc
cactga

KEGG   Homo sapiens (human): 123745Help
Entry
123745            CDS       T01001                                 

Gene name
PLA2G4E
Definition
(RefSeq) phospholipase A2 group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    123745 (PLA2G4E)
   00565 Ether lipid metabolism
    123745 (PLA2G4E)
   00590 Arachidonic acid metabolism
    123745 (PLA2G4E)
   00591 Linoleic acid metabolism
    123745 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    123745 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    123745 (PLA2G4E)
   04010 MAPK signaling pathway
    123745 (PLA2G4E)
   04370 VEGF signaling pathway
    123745 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    123745 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    123745 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    123745 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    123745 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    123745 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    123745 (PLA2G4E)
   04913 Ovarian Steroidogenesis
    123745 (PLA2G4E)
   04921 Oxytocin signaling pathway
    123745 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    123745 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    123745 (PLA2G4E)
   04726 Serotonergic synapse
    123745 (PLA2G4E)
   04730 Long-term depression
    123745 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    123745 (PLA2G4E)
 09160 Human Diseases
  09161 Cancers
   05231 Choline metabolism in cancer
    123745 (PLA2G4E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     123745 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 123745
NCBI-ProteinID: NP_001193599
HGNC: 24791
Ensembl: ENSG00000188089
Vega: OTTHUMG00000130371
Pharos: Q3MJ16(Tdark)
UniProt: Q3MJ16
Position
15q15.1
AA seq 868 aa AA seqDB search
MSLQASEGCPGLGTNVFVPQSPQTDEEGSRSGRSFSEFEDTQDLDTPGLPPFCPMAPWGS
EEGLSPCHLLTVRVIRMKNVRQADMLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNE
SFNFQIQSRVKNVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPLNPQGMEEL
EVEFLLEESPSPPETLVTNGVLVSRQVSCLEVHAQSRRRRKREKMKDLLVMVNESFENTQ
RVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCCRSRKKGPISQPLD
CLSDGQVMTLPVGESYELHMKSTPCPETLDVRLGFSLCPAELEFLQKRKVVVAKALKQVL
QLEEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMAT
LYRDPDWSSKNLEPAIFEARRHVVKDKLPSLFPDQLRKFQEELRQRSQEGYRVTFTDFWG
LLIETCLGDERNECKLSDQRAALSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGL
QKYGAFIPSELFGSEFFMGRLVKRIPESRICYMLGLWSSIFSLNLLDAWNLSHTSEEFFH
RWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSFREILTHRSFVSEFHNFLS
GLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPLLRPERKAD
LIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVT
FFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYN
ILNNKDTLLQALRLAVEKKKRLKGQCPS
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgagtctccaggcctcggaaggctgtcctggcctgggaactaatgtgtttgtcccacag
agcccacaaacggatgaagaaggcagcaggtcaggaagaagtttcagtgagttcgaggat
acacaggacctggacactcctggtctcccacctttctgtcctatggctccttggggctct
gaggaggggctgtctccatgccacctgttgacagtgagggtcatccggatgaaaaatgtc
cggcaggctgatatgctgagccagacagactgttttgtgagcctctggctgcccaccgcc
tctcagaagaagctgaggacaaggaccatctccaactgcccaaatccagagtggaatgaa
agcttcaacttccagatccagagccgagtgaagaacgtgctagagttgagtgtctgtgat
gaagacacagtgacaccagatgaccatctcctgacagttctctatgacctcaccaagctc
tgtttccgaaagaaaacccacgtgaagtttccactcaacccgcagggcatggaagagctg
gaggtggagttcctgctggaggagagtccctctccacctgagaccctcgtcaccaatggc
gtgctggtgtctcgacaagtctcctgcctggaggttcatgcacaatccaggaggcggagg
aagagggagaaaatgaaggacctcctggtgatggtgaacgaatcctttgagaacacccag
cgtgtccggccctgcttggaaccctgctgcccaacctctgcctgcttccaaaccgctgcc
tgcttccactaccccaagtacttccagtcccaggtgcacgtggaagtgcccaagagtcac
tggagctgtgggctttgctgccgctctcgcaagaagggccccatcagccagcccctcgac
tgcctttccgatggtcaggtgatgaccctgcctgtgggtgagagttatgaattacacatg
aagtctacaccctgccctgagacactggacgtgcggctgggcttcagcctgtgcccagca
gagctggagtttctgcagaagcggaaggtcgtggtggccaaggccctgaagcaggtgctg
cagctggaggaagacctgcaggaggacgaggtgccgctgatagccatcatggccactggg
ggtggaacaagatccatgacctccatgtatggccacctgctggggctgcagaagctgaac
ctcctggactgtgccagctacatcaccggtctatcaggggccacctggaccatggctacc
ttgtaccgtgaccctgactggtcctccaaaaacttggagcctgctatctttgaggctcgg
agacatgtggtaaaggacaagctaccctccctgttcccagaccagctccgcaaattccag
gaggagctccggcagcgcagccaggaaggctacagggtcacctttacagacttctggggc
ctgctgatagagacctgcctgggggacgagagaaatgaatgcaaactgtcagatcagcgt
gctgctttgagctgcggccagaaccccctgcccatctacctcaccatcaatgtcaaggat
gatgtaagcaaccaggacttcagagagtggttcgagttctccccctacgaggtgggcctg
cagaagtatggggccttcatcccctccgagctcttcggctccgagttcttcatggggcgg
ctggtgaagaggatcccggagtctcgaatctgctacatgctaggcctgtggagcagcatc
ttctccctgaacctgctggatgcctggaacctgtcacacacctcggaggagtttttccac
aggtggacaagggagaaagtgcaggacatcgaagacgagccgatcctgcctgaaatcccc
aaatgtgatgctaacatcctggagaccacggtagtgatcccagggtcatggctgtccaat
tctttccgagaaatccttacccatcggtccttcgtgtctgagtttcacaacttcctgtct
gggctgcagctgcacaccaactacctccagaatggccagttctctaggtggaaagacaca
gtgctagatggtttcccaaaccagctgaccgagtccgcgaaccacctgtgcctgctggac
actgcgttctttgtcaactccagctacccgcccctcctcaggccagagcgaaaagccgac
ctcatcatccacctcaactactgtgctgggtcccagacaaagcccctgaaacaaacctgt
gagtactgcactgtgcagaacatccccttccccaaatacgagctgccagatgagaatgaa
aatctcaaggaatgctacctgatggagaacccccaggaacccgatgcccccatcgtgact
ttcttcccactcatcaatgacactttccgaaaatacaaggcaccaggtgtagagcgaagc
cctgaggagctggagcagggccaggtggacatttatggtcccaaaactccctatgccacc
aaggagctgacatacacagaggccacctttgacaagctggtgaaactctcagagtataac
atcctgaataataaggacactctcctccaggctctgcggctcgcagtggagaagaagaag
cgcctgaagggccagtgtccctcctag

KEGG   Homo sapiens (human): 255189Help
Entry
255189            CDS       T01001                                 

Gene name
PLA2G4F, PLA2G4FZ
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    255189 (PLA2G4F)
   00565 Ether lipid metabolism
    255189 (PLA2G4F)
   00590 Arachidonic acid metabolism
    255189 (PLA2G4F)
   00591 Linoleic acid metabolism
    255189 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    255189 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    255189 (PLA2G4F)
   04010 MAPK signaling pathway
    255189 (PLA2G4F)
   04370 VEGF signaling pathway
    255189 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    255189 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    255189 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    255189 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    255189 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    255189 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    255189 (PLA2G4F)
   04913 Ovarian Steroidogenesis
    255189 (PLA2G4F)
   04921 Oxytocin signaling pathway
    255189 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    255189 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    255189 (PLA2G4F)
   04726 Serotonergic synapse
    255189 (PLA2G4F)
   04730 Long-term depression
    255189 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    255189 (PLA2G4F)
 09160 Human Diseases
  09161 Cancers
   05231 Choline metabolism in cancer
    255189 (PLA2G4F)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     255189 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 255189
NCBI-ProteinID: NP_998765
HGNC: 27396
Ensembl: ENSG00000168907
Vega: OTTHUMG00000172782
Pharos: Q68DD2(Tdark)
UniProt: Q68DD2 A5PKZ7
Position
15q15.1
AA seq 849 aa AA seqDB search
MLWALWPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGTD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPREEYGSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPV
LSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLSDGEQEFLDRRKQVVSKALQQVLGLSEALDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYTQELGVRERSGHSVSLIDLWGLLVEYLLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHNPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTRGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMRDCLYLVDGGFAINSPFPLALLPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDR
HQARERAGA
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgctttgggcactctggccaaggtggctggcagacaagatgctgcccctcctgggggca
gtgctgcttcagaagagagagaagaggggccctctgtggaggcactggcggcgggaaacc
tacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggcacagac
ctgctgtccaaagccgactgctatgtgcaactgtggctgcccacggcgtccccaagccct
gcccagactaggatagtggccaactgcagtgaccccgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaacgtcctggagctcaccctctatgacaaggacatcctg
ggcagcgaccagctctctctgctcctgtttgacctgagaagcctcaagtgtggccaacct
cacaaacacaccttcccactcaaccaccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacgctccggggagatgggacagccccacgggaagagtac
ggctctaggcagctccagctggcagtgcctggagcctacgagaagccacagctcttgccc
ctgcagcctcccacagagccaggcctcccacccacctttaccttccacgtgaacccagtg
ctgagctccaggctacacgtggagctgatggagctgctggcagctgtgcagagtggcccc
agcgcagagttggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggaggaacagtgttctgtggccctgggggagggccaggaggtggct
ctgagcatgaaggtggaaatgagctccggggacctagacctacgccttggctttgacctc
tctgacggggagcaggagtttctggacaggaggaagcaggtcgtgtccaaggccctgcag
caagtgctgggattgagtgaggctctggacagtggccaggtgcctgtagtggctgtgttg
ggttccgggggtggaacccgagccatgtcttctctgtacggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggggtctctgggtctacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacactcaggaactgggggtccgggagcgcagtggccacagcgtgtccctcatcgac
ctctggggcctccttgttgagtatctcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcggtccgccagggtcagaacccttaccccatttacaccagtgtcaac
gtccgcaccaacttgagtggggaagattttgcagagtggtgcgagttcacgccctatgag
gttggcttccccaagtacggggcttatgttcccaccgagctcttcggctcagaactcttc
atgggacgattgctgcagctccagcctgaaccccggatctgttacctgcaaggtatgtgg
ggcagcgcctttgccaccagcctggatgagatcttcctaaagaccgccggctcgggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagacgactgccagaagcctcag
ctgcacaacccctcgaggctgcgaacgaggctcctcaccccacaggggcccttctcccag
gctgtgctggacatattcacctcccgcttcacttccgcccagagctttaacttcacccgg
ggtctctgcttgcacaaggactatgtggctggcagggagttcgtggcctggaaagacaca
cacccggacgccttccccaaccagctcacccccatgcgggactgcctgtacctggtggac
ggaggctttgccatcaactctccgttcccactggctctgctgcctcagagagcagtggac
ctcattctgtcctttgactattccttggaagccccttttgaggtcttgaagatgacagag
aagtactgcctggaccgaggaatccccttccctagcatcgaggtgggccctgaggacatg
gaggaggcccgtgagtgctatctgtttgccaaggctgaggacccccgctcccccattgtg
ctgcacttccccctggttaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgtcatcaacaggccagacaccccctat
ggcatgatgaacttcacctatgagccccaggacttttatcggctggtggccctcagtcga
tacaacgtcctgaacaacgtggagaccttgaagtgcgccctccagctggctctggaccgg
caccaggctcgggagagggcaggggcctga

KEGG   Homo sapiens (human): 283748Help
Entry
283748            CDS       T01001                                 

Gene name
PLA2G4D, cPLA2delta
Definition
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    283748 (PLA2G4D)
   00565 Ether lipid metabolism
    283748 (PLA2G4D)
   00590 Arachidonic acid metabolism
    283748 (PLA2G4D)
   00591 Linoleic acid metabolism
    283748 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    283748 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    283748 (PLA2G4D)
   04010 MAPK signaling pathway
    283748 (PLA2G4D)
   04370 VEGF signaling pathway
    283748 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    283748 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    283748 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    283748 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    283748 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    283748 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    283748 (PLA2G4D)
   04913 Ovarian Steroidogenesis
    283748 (PLA2G4D)
   04921 Oxytocin signaling pathway
    283748 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    283748 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    283748 (PLA2G4D)
   04726 Serotonergic synapse
    283748 (PLA2G4D)
   04730 Long-term depression
    283748 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    283748 (PLA2G4D)
 09160 Human Diseases
  09161 Cancers
   05231 Choline metabolism in cancer
    283748 (PLA2G4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     283748 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 283748
NCBI-ProteinID: NP_828848
OMIM: 612864
HGNC: 30038
Ensembl: ENSG00000159337
Vega: OTTHUMG00000172587
Pharos: Q86XP0(Tdark)
UniProt: Q86XP0
Structure
PDB: 

Position
15q15.1
AA seq 818 aa AA seqDB search
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFK
TKTLTDTSHPVWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLL
RKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQ
DKLELELVLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYL
TVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWY
DLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQ
RSPNFLQGLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVDAAYFINTSSPSMF
RPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDQHQPRECHLFSDPA
CPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSNMTYKEEDFER
LLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgtcacctgggggaccacctggccacccttaccagggggaggcctctacc
tgctggcagctcacagtgagggtcctggaggcgcggaacctgcgctgggctgacctgttg
agtgaggccgacccttacgtgatcctacagctgtcgaccgcacctggaatgaagtttaag
accaagacgctcaccgacaccagtcatcctgtgtggaatgaggccttccgtttccttatc
caaagtcaggtcaagaatgttctggagcttagcatctatgatgaggactcagtcacggag
gatgacatctgcttcaaggttctctatgacatctcagaagtcctccctggcaagctgctc
cggaaaaccttctcccagagtccccagggagaggaggagctggatgtggagttcctgatg
gaagaaacgtcagatcgcccagaaaacctcatcaccaacaaagtcattgtggcccgagag
ctgtcatgcctggatgtgcatctggacagcacagggagcaccgctgtggttgcagatcag
gacaagctggagctggagctggtgctgaaggggtcctatgaggacacacagacatccttc
ctgggcacagcctctgccttccgcttccactacatggcagccctagagacagagctgagc
gggcgcctgaggagctccagaagcaatggctggaatggggacaactcagctgggtacctc
actgtgcccctgaggcccttgaccattgggaaggaggtgactatggatgttcctgctcca
aatgccccaggagtgaggctgcagctcaaggcagagggctgccctgaggagctggccgtg
cacctgggcttcaatctctgtgcagaggagcaggccttcctgagcaggaggaagcaggtg
gtggccaaggccctgaagcaggccctgcagctggacagagacctgcaggaggatgaggta
cccgttgtgggcatcatggccacaggaggaggtgcccgggccatgacctcactctacggc
cacctattggccttgcagaagctgggcctcctagactgtgtgacctacttcagtggcatc
tctggctctacgtggacaatggcccacctgtacggggaccctgagtggtcgcagagggac
ctggagggacctatcagatacgcccgggagcacctggccaagagcaagctggaggtcttt
tccccagagcgcctggcgagctaccgccgggagctggagctgcgggctgagcagggccac
cccacgacctttgtggacctgtgggcgctagtgctggagtccatgctgcacggccaggtg
atggatcagaagctgtcaggacagagagccgccctggaacggggtcagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggagacactggacttcaaggagtgg
gttgagttctccccctatgaggtcggtttcctgaagtacggggccttcgtccctcctgag
ctcttcggctccgagttcttcatgggacggctgatgaggaggatcccggagccccggatc
tgctttctggaagccatctggagcaacattttctccctgaacctgctggatgcctggtat
gacctcaccagttctggggagtcctggaaacagcacatcaaggacaagaccaggagctta
gagaaggagcccctgaccacctcggggacctcctcgcggctggaggcctcgtggctgcag
ccaggcacggcgctggcccaggcatttaaaggcttcctgacaggcaggcccctccaccag
cgcagccccaacttcctccagggcctccagctgcaccaggactactgtagccacaaagac
ttctccacctgggcagactaccagcttgactccatgcccagccagctgacccccaaggag
ccccggctctgcctggtggacgccgcctacttcatcaacaccagctctccctccatgttc
cggccaggccgcaggctggacctcatcctctccttcgactactccctatctgcgcccttc
gaggcactgcagcagacggagctgtactgccgggcccgggggctgcccttcccccgggtg
gaacccagccctcaggaccagcaccagccaagggaatgccacctcttctcagaccccgcc
tgccccgaggccccgatcctgctgcacttcccgctggtcaatgcctccttcaaggaccac
tcagcccccggtgtccagcgcagccccgcagagctccagggtggccaagtggatctcacc
ggggccacctgcccctacaccctgtccaacatgacctacaaggaggaagacttcgagcgc
ctgctgcggctcagtgactacaacgtgcagaccagccagggtgccatcctgcaggccctg
aggaccgcgctgaagcaccggactctagaggcgaggcctccaagggcacagacctga

KEGG   Homo sapiens (human): 5321Help
Entry
5321              CDS       T01001                                 

Gene name
PLA2G4A, PLA2G4, cPLA2, cPLA2-alpha
Definition
(RefSeq) phospholipase A2 group IVA
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Drug target
Ecopladib: D03938
Efipladib: D06674
Giripladib: D06600
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5321 (PLA2G4A)
   00565 Ether lipid metabolism
    5321 (PLA2G4A)
   00590 Arachidonic acid metabolism
    5321 (PLA2G4A)
   00591 Linoleic acid metabolism
    5321 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    5321 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5321 (PLA2G4A)
   04010 MAPK signaling pathway
    5321 (PLA2G4A)
   04370 VEGF signaling pathway
    5321 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    5321 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5321 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5321 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    5321 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    5321 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5321 (PLA2G4A)
   04913 Ovarian Steroidogenesis
    5321 (PLA2G4A)
   04921 Oxytocin signaling pathway
    5321 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5321 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    5321 (PLA2G4A)
   04726 Serotonergic synapse
    5321 (PLA2G4A)
   04730 Long-term depression
    5321 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5321 (PLA2G4A)
 09160 Human Diseases
  09161 Cancers
   05231 Choline metabolism in cancer
    5321 (PLA2G4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5321 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 5321
NCBI-ProteinID: NP_077734
OMIM: 600522
HGNC: 9035
Ensembl: ENSG00000116711
Vega: OTTHUMG00000035512
Pharos: P47712(Tchem)
UniProt: P47712
Structure
PDB: 

Position
1q31.1
AA seq 749 aa AA seqDB search
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYKAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttatagatccttaccagcacattatagtggagcaccagtattcccacaagttt
acggtagtggtgttacgtgccaccaaagtgacaaagggggcctttggtgacatgcttgat
actccagatccctatgtggaactttttatctctacaacccctgacagcaggaagagaaca
agacatttcaataatgacataaaccctgtgtggaatgagacctttgaatttattttggat
cctaatcaggaaaatgttttggagattacgttaatggatgccaattatgtcatggatgaa
actctagggacagcaacatttactgtatcttctatgaaggtgggagaaaagaaagaagtt
ccttttattttcaaccaagtcactgaaatggttctagaaatgtctcttgaagtttgctca
tgcccagacctacgatttagtatggctctgtgtgatcaggagaagactttcagacaacag
agaaaagaacacataagggagagcatgaagaaactcttgggtccaaagaatagtgaagga
ttgcattctgcacgtgatgtgcctgtggtagccatattgggttcaggtgggggtttccga
gccatggtgggattctctggtgtgatgaaggcattatacgaatcaggaattctggattgt
gctacctacgttgctggtctttctggctccacctggtatatgtcaaccttgtattctcac
cctgattttccagagaaagggccagaggagattaatgaagaactaatgaaaaatgttagc
cacaatccccttttacttctcacaccacagaaagttaaaagatatgttgagtctttatgg
aagaagaaaagctctggacaacctgtcacctttactgatatctttgggatgttaatagga
gaaacactaattcataatagaatgaatactactctgagcagtttgaaggaaaaagttaat
actgcacaatgccctttacctcttttcacctgtcttcatgtcaaacctgacgtttcagag
ctgatgtttgcagattgggttgaatttagtccatacgaaattggcatggctaaatatggt
acttttatggctcccgacttatttggaagcaaattttttatgggaacagtcgttaagaag
tatgaagaaaaccccttgcatttcttaatgggtgtctggggcagtgccttttccatattg
ttcaacagagttttgggcgtttctggttcacaaagcagaggctccacaatggaggaagaa
ttagaaaatattaccacaaagcatattgtgagtaatgatagctcggacagtgatgatgaa
tcacacgaacccaaaggcactgaaaatgaagatgctggaagtgactatcaaagtgataat
caagcaagttggattcatcgtatgataatggccttggtgagtgattcagctttattcaat
accagagaaggacgtgctgggaaggtacacaacttcatgctgggcttgaatctcaataca
tcttatccactgtctcctttgagtgactttgccacacaggactcctttgatgatgatgaa
ctggatgcagctgtagcagatcctgatgaatttgagcgaatatatgagcctctggatgtc
aaaagtaaaaagattcatgtagtggacagtgggctcacatttaacctgccgtatcccttg
atactgagacctcagagaggggttgatctcataatctcctttgacttttctgcaaggcca
agtgactctagtcctccgttcaaggaacttctacttgcagaaaagtgggctaaaatgaac
aagctcccctttccaaagattgatccttatgtgtttgatcgggaagggctgaaggagtgc
tatgtctttaaacccaagaatcctgatatggagaaagattgcccaaccatcatccacttt
gttctggccaacatcaacttcagaaagtacaaggctccaggtgttccaagggaaactgag
gaagagaaagaaatcgctgactttgatatttttgatgacccagaatcaccattttcaacc
ttcaattttcaatatccaaatcaagcattcaaaagactacatgatcttatgcacttcaat
actctgaacaacattgatgtgataaaagaagccatggttgaaagcattgaatatagaaga
cagaatccatctcgttgctctgtttcccttagtaatgttgaggcaagaagatttttcaac
aaggagtttctaagtaaacccaaagcatag

KEGG   Homo sapiens (human): 8605Help
Entry
8605              CDS       T01001                                 

Gene name
PLA2G4C, CPLA2-gamma
Definition
(RefSeq) phospholipase A2 group IVC
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8605 (PLA2G4C)
   00565 Ether lipid metabolism
    8605 (PLA2G4C)
   00590 Arachidonic acid metabolism
    8605 (PLA2G4C)
   00591 Linoleic acid metabolism
    8605 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    8605 (PLA2G4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8605 (PLA2G4C)
   04010 MAPK signaling pathway
    8605 (PLA2G4C)
   04370 VEGF signaling pathway
    8605 (PLA2G4C)
   04072 Phospholipase D signaling pathway
    8605 (PLA2G4C)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8605 (PLA2G4C)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    8605 (PLA2G4C)
   04664 Fc epsilon RI signaling pathway
    8605 (PLA2G4C)
  09152 Endocrine system
   04912 GnRH signaling pathway
    8605 (PLA2G4C)
   04913 Ovarian Steroidogenesis
    8605 (PLA2G4C)
   04921 Oxytocin signaling pathway
    8605 (PLA2G4C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8605 (PLA2G4C)
  09156 Nervous system
   04724 Glutamatergic synapse
    8605 (PLA2G4C)
   04726 Serotonergic synapse
    8605 (PLA2G4C)
   04730 Long-term depression
    8605 (PLA2G4C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8605 (PLA2G4C)
 09160 Human Diseases
  09161 Cancers
   05231 Choline metabolism in cancer
    8605 (PLA2G4C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8605 (PLA2G4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 8605
NCBI-ProteinID: NP_003697
OMIM: 603602
HGNC: 9037
Ensembl: ENSG00000105499
Vega: OTTHUMG00000183185
Pharos: Q9UP65(Tchem)
UniProt: Q9UP65 A0A024QZH0
Position
19q13.33
AA seq 541 aa AA seqDB search
MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACL
GVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSL
QKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQ
PSWQEARAPETWFEFTPHHAGFSALGAFVSITHFGSKFKKGRLVRTHPERDLTFLRGLWG
SALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLIFARLLRLQESSQGEHPPPED
EGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGICASKWEWGTT
HNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFET
IRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIE
AWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKDSARSCCL
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggaagctctgaagtttccataattcctgggctccagaaagaagaaaaggcggccgtg
gagagacgaagacttcatgtgctgaaagctctgaagaagctaaggattgaggctgatgag
gccccagttgttgctgtgctgggctcaggcggaggactgcgggctcacattgcctgcctt
ggggtcctgagtgagatgaaagaacagggcctgttggatgccgtcacgtacctcgcaggg
gtctctggatccacttgggcaatatcttctctctacaccaatgatggtgacatggaagct
ctcgaggctgacctgaaacatcgatttacccgacaggagtgggacttggctaagagccta
cagaaaaccatccaagcagcgaggtctgagaattactctctgaccgacttctgggcctac
atggttatctctaagcaaaccagagaactgccggagtctcatttgtccaatatgaagaag
cccgtggaagaagggacactaccctacccaatatttgcagccattgacaatgacctgcaa
ccttcctggcaggaggcaagagcaccagagacctggttcgagttcacccctcaccacgct
ggcttctctgcactgggggcctttgtttccataacccacttcggaagcaaattcaagaag
ggaagactggtcagaactcaccctgagagagacctgactttcctgagaggtttatgggga
agtgctcttggtaacactgaagtcattagggaatacatttttgaccagttaaggaatctg
accctgaaaggtttatggagaagggctgttgctaatgctaaaagcattggacaccttatt
tttgcccgattactgaggctgcaagaaagttcacaaggggaacatcctcccccagaagat
gaaggcggtgagcctgaacacacctggctgactgagatgctcgagaattggaccaggacc
tccctggaaaagcaggagcagccccatgaggaccccgaaaggaaaggctcactcagtaac
ttgatggattttgtgaagaaaacaggcatttgcgcttcaaagtgggaatgggggaccact
cacaacttcctgtacaaacacggtggcatccgggacaagataatgagcagccggaagcac
ctccacctggtggatgctggtttagccatcaacactcccttcccactcgtgctgcccccg
acgcgggaggttcacctcatcctctccttcgacttcagtgccggagatcctttcgagacc
atccgggctaccactgactactgccgccgccacaagatcccctttccccaagtagaagag
gctgagctggatttgtggtccaaggcccccgccagctgctacatcctgaaaggagaaact
ggaccagtggtgatgcattttcccctgttcaacatagatgcctgtggaggtgatattgag
gcatggagtgacacatacgacacattcaagcttgctgacacctacactctagatgtggtg
gtgctactcttggcattagccaagaagaatgtcagggaaaacaagaagaagatccttaga
gagttgatgaacgtggccgggctctactacccgaaggatagtgcccgaagttgctgcttg
gcatag

KEGG   Homo sapiens (human): 8681Help
Entry
8681              CDS       T01001                                 

Gene name
JMJD7-PLA2G4B, HsT16992, cPLA2-beta
Definition
(RefSeq) JMJD7-PLA2G4B readthrough
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8681 (JMJD7-PLA2G4B)
   00565 Ether lipid metabolism
    8681 (JMJD7-PLA2G4B)
   00590 Arachidonic acid metabolism
    8681 (JMJD7-PLA2G4B)
   00591 Linoleic acid metabolism
    8681 (JMJD7-PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    8681 (JMJD7-PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8681 (JMJD7-PLA2G4B)
   04010 MAPK signaling pathway
    8681 (JMJD7-PLA2G4B)
   04370 VEGF signaling pathway
    8681 (JMJD7-PLA2G4B)
   04072 Phospholipase D signaling pathway
    8681 (JMJD7-PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8681 (JMJD7-PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    8681 (JMJD7-PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    8681 (JMJD7-PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    8681 (JMJD7-PLA2G4B)
   04913 Ovarian Steroidogenesis
    8681 (JMJD7-PLA2G4B)
   04921 Oxytocin signaling pathway
    8681 (JMJD7-PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8681 (JMJD7-PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    8681 (JMJD7-PLA2G4B)
   04726 Serotonergic synapse
    8681 (JMJD7-PLA2G4B)
   04730 Long-term depression
    8681 (JMJD7-PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8681 (JMJD7-PLA2G4B)
 09160 Human Diseases
  09161 Cancers
   05231 Choline metabolism in cancer
    8681 (JMJD7-PLA2G4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8681 (JMJD7-PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 8681
NCBI-ProteinID: NP_001185517
HGNC: 34449
Ensembl: ENSG00000168970
Vega: OTTHUMG00000044442
Pharos: P0C869(Tchem)
UniProt: P0C869
Position
15q15.1
AA seq 893 aa AA seqDB search
MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQH
WPALQKWSLPYFRATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRA
QHPGVLYVQKQCSNLPSELPQLLPDLESHVPWASEALGKMPDAVNFWLGEAAAVTSLHKD
HYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKAEVSRT
CLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVWNQSFHFRIH
RQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEGRLEVEFRLQ
SLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGPQEASVGTGT
FRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMRVELKKEAGL
RELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIMATGGGIRAM
TSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTELLKTQVTKN
KLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLSDQREALSHG
QNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFFMGQLMKRL
PESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPLLKIEEPPST
AGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGLPNQLTPSEP
HLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQGSGGHPRRRQLGR
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcggctttggaagccgtgcggagcgagttacgagaattcccggccgctgca
agggagctctgcgtgcctcttgctgtgccctacctggacaaacccccaactccgctccac
ttctaccgggactgggtctgccccaacaggccgtgcattatccgcaacgctctgcagcac
tggccggccctccagaagtggtccctcccctatttcagagccacagtgggctccacagag
gtgagtgtggccgtgaccccagatggttacgcggatgccgtgagaggggatcgcttcatg
atgccagctgagcgccgcctgcccctgagcttcgtgctggatgtgctggagggccgggcc
cagcaccctggagtcctctatgtgcagaagcagtgctccaacctgcccagcgagctgccc
cagctgctgcctgatctggaatcccatgtgccctgggcctccgaagccctgggaaagatg
cccgatgctgtgaacttctggctgggggaggcggctgcagtgacttctttgcacaaggac
cactatgagaacctctactgcgtggtctcaggagagaagcatttcctgttccatccgccc
agcgaccggcccttcatcccctatgagctgtacacgccggcaacctaccagctaactgaa
gagggcacctttaaggtggtggatgaagaggccatggagaaggcagaggtgtccaggacc
tgcctgctcacggttcgtgtcctgcaggcccatcgcctaccctctaaggacctagtgacc
ccctctgactgctacgtgactctctggctgcccacggcctgcagccacaggctccagaca
cgcacggtcaagaacagcagtagccctgtctggaaccagagctttcacttcaggatccac
aggcagctcaagaatgtcatggaactgaaagtctttgaccaggacctggtgaccggagat
gaccctgtgttgtcagtactgtttgatgcggggactctgcgggctggggagttccggcgc
gagagcttctcactgagccctcagggtgaggggcgcctggaagttgaatttcgcctgcag
agtctggctgaccgtggcgagtggctcgtcagcaatggcgttctggtggcccgggagctc
tcctgcttgcacgttcaactggaggagacaggagaccagaagtcctcagagcacagagtt
cagcttgtggttcctgggtcctgtgagggtccgcaggaggcctctgtgggcactggcacc
ttccgcttccactgcccagcctgctgggagcaggagctgagtattcgcctgcaggatgcc
cccgaggagcaactaaaggcgccactgagtgccctgccctctggtcaagtggtgaggctt
gtcttccccacgtcccaggagcccctgatgagagtggagctgaaaaaagaagcaggactg
agggagctggccgtgcgactgggcttcgggccctgtgcagaggagcaggccttcctgagc
aggaggaagcaggtggtggccgcggccttgaggcaggccctgcagctggacggagacctg
caggaggatgagatcccagtggtagctattatggccactggtggtgggatccgggcaatg
acttccctgtatgggcagctggctggcctgaaggagctgggcctcttggattgcgtctcc
tacatcaccggggcctcgggctccacctgggccttggccaacctttatgaggacccagag
tggtctcagaaggacctggcagggcccactgagttgctgaagacccaggtgaccaagaac
aagctgggtgtgctggcccccagccagctgcagcggtaccggcaggagctggccgagcgt
gcccgcttgggctacccaagctgcttcaccaacctgtgggccctcatcaacgaggcgctg
ctgcatgatgagccccatgatcacaagctctcagatcaacgggaggccctgagtcatggc
cagaaccctctgcccatctactgtgccctcaacaccaaagggcagagcctgaccactttt
gaatttggggagtggtgcgagttctctccctacgaggtcggcttccccaagtacggggcc
ttcatcccctctgagctctttggctccgagttctttatggggcagctgatgaagaggctt
cctgagtcccgcatctgcttcttagaaggtatctggagcaacctgtatgcagccaacctc
caggacagcttatactgggcctcagagcccagccagttctgggaccgctgggtcaggaac
caggccaacctggacaaggagcaggtcccccttctgaagatagaagaaccaccctcaaca
gccggcaggatagctgagtttttcaccgatcttctgacgtggcgtccactggcccaggcc
acacataatttcctgcgtggcctccatttccacaaagactactttcagcatcctcacttc
tccacatggaaagctaccactctggatgggctccccaaccagctgacaccctcggagccc
cacctgtgcctgctggatgttggctacctcatcaataccagctgcctgcccctcctgcag
cccactcgggacgtggacctcatcctgtcattggactacaacctccacggagccttccag
gggtccggcggacacccgaggaggcggcagctggggaggtga

DBGET integrated database retrieval system