KEGG   Homo sapiens (human): 10017
Entry
10017             CDS       T01001                                 

Gene name
BCL2L10, BCL-B, Boo, Diva, bcl2-L-10
Definition
(RefSeq) BCL2 like 10
  KO
K18451  Bcl-2-like protein 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    10017 (BCL2L10)
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 10017
NCBI-ProteinID: NP_065129
OMIM: 606910
HGNC: 993
Ensembl: ENSG00000137875
Vega: OTTHUMG00000131893
Pharos: Q9HD36(Tchem)
UniProt: Q9HD36
Structure
PDB: 
4B4S

Position
15q21.2
AA seq 204 aa
MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIH
RSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKK
WGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWR
KQLVQAFLSCLLTTAFIYLWTRLL
NT seq 615 nt   +upstreamnt  +downstreamnt
atggttgaccagttgcgggagcgcaccaccatggccgacccgctgcgggagcgcaccgag
ctgttgctggccgactacctggggtactgcgcccgggaacccggcacccccgagccggcg
ccatccacgcccgaggccgccgtgctgcgctccgcggccgccaggttacggcagattcac
cggtcctttttctccgcctacctcggctaccccgggaaccgcttcgagctggtggcgctg
atggcggattccgtgctctccgacagccccggccccacctggggcagagtggtgacgctc
gtgaccttcgcagggacgctgctggagagagggccgctggtgaccgcccggtggaagaag
tggggcttccagccgcggctaaaggagcaggagggcgacgtcgcccgggactgccagcgc
ctggtggccttgctgagctcgcggctcatggggcagcaccgcgcctggctgcaggctcag
ggcggctgggatggcttttgtcacttcttcaggaccccctttccactggctttttggaga
aaacagctggtccaggcttttctgtcatgcttgttaacaacagccttcatttatctctgg
acacgattattatga

DBGET integrated database retrieval system