KEGG   Homo sapiens (human): 1002Help
Entry
1002              CDS       T01001                                 

Gene name
CDH4, CAD4, R-CAD, RCAD
Definition
(RefSeq) cadherin 4
  KO
K06797  cadherin 4, type 1, R-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1002 (CDH4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    1002 (CDH4)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1002 (CDH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_3 He_PIG Stevor
Motif
Other DBs
NCBI-GeneID: 1002
NCBI-ProteinID: NP_001785
OMIM: 603006
HGNC: 1763
Ensembl: ENSG00000179242
Vega: OTTHUMG00000032890
Pharos: P55283(Tbio)
UniProt: P55283
Position
20q13.33
AA seq 916 aa AA seqDB search
MTAGAGVLLLLLSLSGALRAHNEDLTTRETCKAGFSEDDYTALISQNILEGEKLLQVKFS
SCVGTKGTQYETNSMDFKVGADGTVFATRELQVPSEQVAFTVTAWDSQTAEKWDAVVRLL
VAQTSSPHSGHKPQKGKKVVALDPSPPPKDTLLPWPQHQNANGLRRRKRDWVIPPINVPE
NSRGPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPMEVFSIDSMSGRMYVTRPMDREEH
ASYHLRAHAVDMNGNKVENPIDLYIYVIDMNDNRPEFINQVYNGSVDEGSKPGTYVMTVT
ANDADDSTTANGMVRYRIVTQTPQSPSQNMFTINSETGDIVTVAAGLDREKVQQYTVIVQ
ATDMEGNLNYGLSNTATAIITVTDVNDNPPEFTASTFAGEVPENRVETVVANLTVMDRDQ
PHSPNWNAVYRIISGDPSGHFSVRTDPVTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPL
ASGIQMSFQSTAGVTISIMDINEAPYFPSNHKLIRLEEGVPPGTVLTTFSAVDPDRFMQQ
AVRYSKLSDPASWLHINATNGQITTAAVLDRESLYTKNNVYEATFLAADNGIPPASGTGT
LQIYLIDINDNAPELLPKEAQICEKPNLNAINITAADADVDPNIGPYVFELPFVPAAVRK
NWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCDDNGDCT
TIGAVAAAGLGTGAIVAILICILILLTMVLLFVMWMKRREKERHTKQLLIDPEDDVRDNI
LKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPG
DIGDFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSSGDQDYDYLNDWG
PRFKKLADMYGGGEED
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgggcgccggcgtgctccttctgctgctctcgctctccggcgcgctccgggcc
cataatgaggatcttacaactagagagacctgcaaggctgggttctctgaagatgattac
acggcattaatctcccaaaatattctagaaggggaaaagctacttcaagtcaagttcagc
agctgtgtggggaccaaggggacacaatatgagaccaacagcatggacttcaaagttggg
gcagatgggacagtcttcgccacccgggagctgcaggtcccctccgagcaggtggcgttc
acggtgactgcatgggacagccagacagcagagaaatgggacgccgtggtgcggttgctg
gtggcccagacctcgtccccgcactctggacacaagccgcagaaaggaaagaaggtcgtg
gctctggacccctctccgcctccgaaggacaccctgctgccgtggccccagcaccagaac
gccaacgggctgaggcggcgcaaacgggactgggtcatcccgcccatcaacgtgcccgag
aactcgcgcgggcccttcccgcagcagctcgtgaggatccggtccgacaaagacaatgac
atccccatccggtacagcatcacgggagtgggcgccgaccagccccccatggaggtcttc
agcattgactccatgtccggccggatgtacgtcacaaggcccatggaccgggaggagcac
gcctcttaccacctccgagcccacgctgtggacatgaatggcaacaaggtggagaacccc
atcgacctgtacatctacgtcatcgacatgaatgacaaccgccctgagttcatcaaccag
gtctacaacggctccgtggacgagggctccaagccaggcacctacgtgatgaccgtcacg
gccaacgatgctgacgacagcaccacggccaacgggatggtgcggtaccggatcgtgacc
cagaccccacagagcccgtcccagaatatgttcaccatcaacagcgagactggagatatc
gtcacagtggcggctggcctggaccgagagaaagttcagcagtacacagtcatcgttcag
gccacagatatggaaggaaatctcaactatggcctctcaaacacagccacagccatcatc
acggtgacagatgtgaatgacaacccgccagaatttaccgccagcacgtttgcaggggag
gtccccgaaaaccgcgtggagaccgtggtcgcaaacctcacggtgatggaccgagatcag
ccccactctccaaactggaatgccgtttaccgcatcatcagtggggatccatccgggcac
ttcagcgtccgcacagaccccgtaaccaacgagggcatggtcaccgtggtgaaggcagtc
gactacgagctcaacagagctttcatgctgacagtgatggtgtccaaccaggcgcccctg
gccagcggaatccagatgtccttccagtccacggcaggggtgaccatctccatcatggac
atcaacgaggctccctacttcccctcaaaccacaagctgatccgcctggaggagggcgtg
ccccccggcaccgtgctgaccacgttttcagctgtggaccctgaccggttcatgcagcag
gctgtgagatactcaaagctgtcagacccagcgagctggctgcacatcaatgccaccaac
ggccagatcaccacggcggcagtgctggaccgtgagtccctctacaccaaaaacaacgtc
tacgaggccaccttcctggcagctgacaatgggatacccccggccagcggcaccgggacc
ctccagatctatctcattgacatcaacgacaacgcccctgagctgctgcccaaggaggcg
cagatctgcgagaagcccaacctgaacgccatcaacatcacggcggccgacgctgacgtc
gaccccaacatcggcccctacgtcttcgagctgccctttgtcccggcggccgtgcggaag
aactggaccatcacccgcctgaacggtgactatgcccaactcagcttgcgcatcctgtac
ctggaggccgggatgtatgacgtccccatcatcgtcacagactctggaaaccctcccctg
tccaacacgtccatcatcaaagtcaaggtgtgcccatgtgatgacaacggggactgcacc
accattggcgcagtggcagcggctggtctgggcaccggtgccatcgtggccatcctcatc
tgcatcctcatcctgctgaccatggtcctgctgtttgtcatgtggatgaagcggcgagag
aaggagcgccacacgaagcagctgctcattgaccccgaggacgacgtccgcgacaacatc
ctcaagtatgacgaggaaggcggtggcgaggaggaccaggactacgacctcagccagctg
cagcagccggaagccatggggcacgtgccaagcaaagcccctggcgtgcgtcgcgtggat
gagcggccggtgggcgctgagccccagtacccgatcaggcccatggtgccgcacccaggc
gacatcggtgacttcatcaatgagggactccgcgctgctgacaacgaccccacggcaccc
ccctatgactccctgctggtcttcgactacgaggggagcggctccaccgcaggctccgtc
agctccctgaactcatccagttccggggaccaagactacgattacctcaacgactggggg
cccagattcaagaagctggcggacatgtatggaggtggtgaagaggattga

DBGET integrated database retrieval system