KEGG   Homo sapiens (human): 10021Help
Entry
10021             CDS       T01001                                 

Gene name
HCN4, SSS2
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide gated potassium channel 4
  KO
K04957  hyperpolarization activated cyclic nucleotide-gated potassium channel 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04742  Taste transduction
Disease
H00728  Brugada syndrome
H00729  Sick sinus syndrome
Drug target
Ivabradine (DG00246): D07165 D08095
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10021 (HCN4)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    10021 (HCN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    10021 (HCN4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   10021 (HCN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 10021
NCBI-ProteinID: NP_005468
OMIM: 605206
HGNC: 16882
Ensembl: ENSG00000138622
Vega: OTTHUMG00000137563
Pharos: Q9Y3Q4(Tclin)
UniProt: Q9Y3Q4
Structure
PDB: 

Position
15q24.1
AA seq 1203 aa AA seqDB search
MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDAEEEGAGGRQDPSRRSIRLRPLPSPSPSA
AAGGTESRSSALGAADSEGPARGAGKSSTNGDCRRFRGSLASLGSRGGGSGGTGSGSSHG
HLHDSAEERRLIAEGDASPGEDRTPPGLAAEPERPGASAQPAASPPPPQQPPQPASASCE
QPSVDTAIKVEGGAAAGDQILPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAV
EREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNV
VSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVE
TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVN
LIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIG
YGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD
PNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGE
ICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSI
LLHKVQHDLNSGVFNYQENEIIQQIVQHDREMAHCAHRVQAAASATPTPTPVIWTPLIQA
PLQAAAATTSVAIALTHHPRLPAAIFRPPPGSGLGNLGAGQTPRHLKRLQSLIPSALGSA
SPASSPSQVDTPSSSSFHIQQLAGFSAPAGLSPLLPSSSSSPPPGACGSPSAPTPSAGVA
ATTIAGFGHFHKALGGSLSSSDSPLLTPLQPGARSPQAAQPSPAPPGARGGLGLPEHFLP
PPPSSRSPSSSPGQLGQPPGELSLGLATGPLSTPETPPRQPEPPSLVAGASGGASPVGFT
PRGGLSPPGHSPGPPRTFPSAPPRASGSHGSLLLPPASSPPPPQVPQRRGTPPLTPGRLT
QDLKLISASQPALPQDGAQTLRRASPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGR
PYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLP
SNL
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atggacaagctgccgccgtccatgcgcaagcggctctacagcctcccgcagcaggtgggg
gccaaggcgtggatcatggacgaggaagaggacgccgaggaggagggggccgggggccgc
caagaccccagccgcaggagcatccggctgcggccactgccctcgccctccccctcggcg
gccgcgggtggcacggagtcccggagctcggccctcggggcagcggacagcgaagggccg
gcccgcggcgcgggcaagtccagcacgaacggcgactgcaggcgcttccgcgggagcctg
gcctcgctgggcagccggggcggcggcagcggcggcacggggagcggcagcagtcacgga
cacctgcatgactccgcggaggagcggcggctcatcgccgagggcgacgcgtcccccggc
gaggacaggacgcccccaggcctggcggccgagcccgagcgccccggcgcctcggcgcag
cccgcagcctcgccgccgccgccccagcagccaccgcagccggcctccgcctcctgcgag
cagccctcggtggacaccgctatcaaagtggagggaggcgcggctgccggcgaccagatc
ctcccggaggccgaggtgcgcctgggccaggccggcttcatgcagcgccagttcggggcc
atgctccaacccggggtcaacaaattctccctaaggatgttcggcagccagaaagccgtg
gagcgcgaacaggagagggtcaagtcggccggattttggattatccacccctacagtgac
ttcagattttactgggacctgaccatgctgctgctgatggtgggaaacctgattatcatt
cctgtgggcatcaccttcttcaaggatgagaacaccacaccctggattgtcttcaatgtg
gtgtcagacacattcttcctcatcgacttggtcctcaacttccgcacagggatcgtggtg
gaggacaacacagagatcatcctggacccgcagcggattaaaatgaagtacctgaaaagc
tggttcatggtagatttcatttcctccatccccgtggactacatcttcctcattgtggag
acacgcatcgactcggaggtctacaagactgcccgggccctgcgcattgtccgcttcacg
aagatcctcagcctcttacgcctgttacgcctctcccgcctcattcgatatattcaccag
tgggaagagatcttccacatgacctacgacctggccagcgccgtggtgcgcatcgtgaac
ctcatcggcatgatgctcctgctctgccactgggacggctgcctgcagttcctggtaccc
atgctacaggacttccctgacgactgctgggtgtccatcaacaacatggtgaacaactcc
tgggggaagcagtactcctacgcgctcttcaaggccatgagccacatgctgtgcatcggc
tacgggcggcaggcgcccgtgggcatgtccgacgtctggctcaccatgctcagcatgatc
gtgggtgccacctgctacgccatgttcattggccacgccactgccctcatccagtccctg
gactcctcccggcgccagtaccaggaaaagtacaagcaggtggagcagtacatgtccttt
cacaagctcccgcccgacacccggcagcgcatccacgactactacgagcaccgctaccag
ggcaagatgttcgacgaggagagcatcctgggcgagctaagcgagcccctgcgggaggag
atcatcaactttaactgtcggaagctggtggcctccatgccactgtttgccaatgcggac
cccaacttcgtgacgtccatgctgaccaagctgcgtttcgaggtcttccagcctggggac
tacatcatccgggaaggcaccattggcaagaagatgtacttcatccagcatggcgtggtc
agcgtgctcaccaagggcaacaaggagaccaagctggccgacggctcctactttggagag
atctgcctgctgacccggggccggcgcacagccagcgtgagggccgacacctactgccgc
ctctactcgctgagcgtggacaacttcaatgaggtgctggaggagtaccccatgatgcga
agggccttcgagaccgtggcgctggaccgcctggaccgcattggcaagaagaactccatc
ctcctccacaaagtccagcacgacctcaactccggcgtcttcaactaccaggagaatgag
atcatccagcagattgtgcagcatgaccgggagatggcccactgcgcgcaccgcgtccag
gctgctgcctctgccaccccaacccccacgcccgtcatctggaccccgctgatccaggca
ccactgcaggctgccgctgccaccacttctgtggccatagccctcacccaccaccctcgc
ctgcctgctgccatcttccgccctcccccaggatctgggctgggcaacctcggtgccggg
cagacgccaaggcacctgaaacggctgcagtccctgatcccttctgcgctgggctccgcc
tcgcccgccagcagcccgtcccaggtggacacaccgtcttcatcctccttccacatccaa
cagctggctggattctctgcccccgctggactgagcccactcctgccctcatccagctcc
tccccaccccccggggcctgtggctccccctcggctcccacaccatcagctggcgtagcc
gccaccaccatagccgggtttggccacttccacaaggcgctgggtggctccctgtcctcc
tccgactctcccctgctcaccccgctgcagccaggcgcccgctccccgcaggctgcccag
ccatctcccgcgccacccggggcccggggaggcctgggactcccggagcacttcctgcca
cccccaccctcatccagatccccgtcatctagccccgggcagctgggccagcctcccggg
gagttgtccctaggtctggccactggcccactgagcacgccagagacacccccacggcag
cctgagccgccgtcccttgtggcaggggcctctgggggggcttcccctgtaggctttact
ccccgaggaggtctcagcccccctggccacagcccaggccccccaagaaccttcccgagt
gccccgccccgggcctctggctcccacggatccttgctcctgccacctgcatccagcccc
ccaccaccccaggtcccccagcgccggggcacacccccgctcacccccggccgcctcacc
caggacctcaagctcatctccgcgtctcagccagccctgcctcaggacggggcgcagact
ctccgcagagcctccccgcactcctcaggggagtccatggctgccttcccgctcttcccc
agggctgggggtggcagcgggggcagtgggagcagcgggggcctcggtccccctgggagg
ccctatggtgccatccccggccagcacgtcactctgcctcggaagacatcctcaggttct
ttgccaccccctctgtctttgtttggggcaagagccacctcttctggggggccccctctg
actgctggaccccagagggaacctggggccaggcctgagccagtgcgctccaaactgcca
tccaatctatga

DBGET integrated database retrieval system