KEGG   Homo sapiens (human): 10022Help
Entry
10022             CDS       T01001                                 

Gene name
INSL5, PRO182, UNQ156
Definition
(RefSeq) insulin like 5
  KO
K22001  insulin-like 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10022 (INSL5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    10022 (INSL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Insulin Ins_beta
Motif
Other DBs
NCBI-GeneID: 10022
NCBI-ProteinID: NP_005469
OMIM: 606413
HGNC: 6088
Ensembl: ENSG00000172410
Vega: OTTHUMG00000009164
Pharos: Q9Y5Q6(Tbio)
CPD: C16178
UniProt: Q9Y5Q6
Position
1p31.3
AA seq 135 aa AA seqDB search
MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAE
TGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTL
CCTDGCSMTDLSALC
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaagggctccattttcactctgtttttattctctgtcctatttgccatctcagaagtg
cggagcaaggagtctgtgagactctgtgggctagaatacatacggacagtcatctatatc
tgtgctagctccaggtggagaaggcatcaggaggggatccctcaagctcagcaagctgag
acaggaaactccttccagctcccacataaacgtgagttttctgaggaaaatccagcgcaa
aaccttccgaaggtggatgcctcaggggaagaccgtctttggggtggacagatgcccact
gaagagctttggaagtcaaagaagcattcagtgatgtcaagacaagatttacaaactttg
tgttgcactgatggctgttccatgactgatttgagtgctctttgctaa

DBGET integrated database retrieval system