KEGG   Homo sapiens (human): 10023Help
Entry
10023             CDS       T01001                                 

Gene name
FRAT1
Definition
(RefSeq) FRAT regulator of WNT signaling pathway 1
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa05200  Pathways in cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    10023 (FRAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10023 (FRAT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    10023 (FRAT1)
   05226 Gastric cancer
    10023 (FRAT1)
   05224 Breast cancer
    10023 (FRAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSK-3_bind
Motif
Other DBs
NCBI-GeneID: 10023
NCBI-ProteinID: NP_005470
OMIM: 602503
HGNC: 3944
Ensembl: ENSG00000165879
Vega: OTTHUMG00000018848
Pharos: Q92837(Tbio)
UniProt: Q92837
Structure
PDB: 

Position
10q24.1
AA seq 279 aa AA seqDB search
MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSP
ASPCGPPGAPLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGR
VRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASR
RLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPL
SAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgccggagggaggaggaagaggaagccggcgaggaggcggagggggaggaagag
gaggaggacagcttcctcctactgcagcagtcagtggcgctgggcagctcgggcgaggtg
gaccggctggtggcccagatcggcgagacgctgcagctggacgcggcgcagcacagcccg
gcctcgccgtgcgggcccccgggggcgccgctgcgggccccggggcccctggctgcggcg
gtgccggcggacaaggccaggtccccggcggtgccgctgctgctgccgcccgcgttggcg
gagactgtgggcccggcgccccctggggtcctgcgctgcgccctgggggaccgcggccgc
gtgcggggccgcgctgcgccctactgcgtggccgagctcgccacaggccccagcgcgctg
tccccactgccccctcaggccgaccttgatgggcctccgggagctggcaagcagggcatc
ccgcagccgctgtcgggtccgtgccggcgaggatggctccggggcgccgccgcctcccgc
cgcctgcagcagcgacgcgggtcccaaccagaaacccgcacaggcgacgacgacccgcac
cggcttctgcagcagctagtgctctctggaaacctcatcaaggaggccgtgcgaaggctt
cattcgcgacggctgcagttacgtgcaaagcttccccaacgcccgctcctgggacctctg
tcggccccggtgcatgaacccccttcgcctcgcagccctcgcgcggcctgcagtgaccct
ggcgcctccgggagggcgcagctcagaactggcgacggcgttcttgtgcctggcagctaa

KEGG   Homo sapiens (human): 23401Help
Entry
23401             CDS       T01001                                 

Gene name
FRAT2, FRAT-2
Definition
(RefSeq) FRAT regulator of WNT signaling pathway 2
  KO
K03096  frequently rearranged in advanced T-cell lymphomas 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa05200  Pathways in cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    23401 (FRAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23401 (FRAT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    23401 (FRAT2)
   05226 Gastric cancer
    23401 (FRAT2)
   05224 Breast cancer
    23401 (FRAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSK-3_bind
Motif
Other DBs
NCBI-GeneID: 23401
NCBI-ProteinID: NP_036215
OMIM: 605006
HGNC: 16048
Ensembl: ENSG00000181274
Vega: OTTHUMG00000018850
Pharos: O75474(Tdark)
UniProt: O75474
Position
10q24.1
AA seq 233 aa AA seqDB search
MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSP
ASPCAPPGVPLRAPGPLAAAVPADKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGR
VRGRAAPYCVAEVAAGPSALPGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQ
QLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGRSGPDRIALQPSGSLL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgccggagggaggaggaagaggaagccggcgaggaggcggagggggaggaagag
gaggacgacagcttcctcctgctgcagcagtcggtgacgctgggcagctcgggcgaggtg
gaccggctggtggcccagatcggcgagacgctgcagctggacgcggcgcaggacagcccg
gcctcgccgtgcgcgcccccgggggtgccgctgcgggccccggggcccctggctgcggcg
gtgccggcggacaaggcccggcccccggcggtgccgctgctgctgccgcccgcttcggct
gagacggtgggcccggcgccctctggggccctgcgctgcgccctaggggaccgcggccgc
gtgcgcggacgcgctgcgccctactgcgtggcggaggtcgccgcaggccccagcgcgctg
ccggggccgtgccggcgaggatggctcagggacgcggtcacctcccgccgcttgcagcag
cgccgatggacccaagccggggcacgcgccggcgacgacgacccgcatcggctcctccag
cagctcgtgctctcgggaaacctcatcaaggaagccgtgcggagactccaacgagccgtc
gccgcggttgcagccacgggccccgcaagcgcccctgggcccgggggaggccgcagcgga
cctgaccgcattgccctgcagccctcaggctccttgctctga

DBGET integrated database retrieval system