KEGG   Homo sapiens (human): 100271849Help
Entry
100271849         CDS       T01001                                 

Gene name
MEF2B, RSRFR2
Definition
(RefSeq) myocyte enhancer factor 2B
  KO
K09261  MADS-box transcription enhancer factor 2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100271849 (MEF2B)
   04022 cGMP-PKG signaling pathway
    100271849 (MEF2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100271849 (MEF2B)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    100271849 (MEF2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF GHD
Motif
Other DBs
NCBI-GeneID: 100271849
NCBI-ProteinID: NP_001139257
OMIM: 600661
HGNC: 6995
Ensembl: ENSG00000213999
Vega: OTTHUMG00000161595
UniProt: Q02080 A0A024R7K5
Structure
PDB: 

Position
19p13.11
AA seq 368 aa AA seqDB search
MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYAST
DMDRVLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEG
GDPALPRPRLYPAAPAMPSPDVVYGALPPPGCDPSGLGEALPAQSRPSPFRPAAPKAGPP
GLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNPCSTAT
PGPPLGSFPFLPGGPPEYGLGDPPPPPGLLQPPTLAPWQPSRGDGPPAVSSQPSGGRSLG
EEGPPTRGASPPTPPVSIKSERLSPAPGGPGDFPKTFPYPLLLARSLAEPLRPGPALRRL
PLADGWPR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggggaggaaaaaaatccagatctcccgcatcctggaccaaaggaatcggcaggtgacg
ttcaccaagcggaagttcgggctgatgaagaaggcctatgagctgagcgtgctctgtgac
tgtgagatagccctcatcatcttcaacagcgccaaccgcctcttccagtatgccagcacg
gacatggaccgtgtgctgctgaagtacacagagtacagcgagccccacgagagccgcacc
aacactgacatcctcgagacgctgaagcggaggggcattggcctcgatgggccagagctg
gagccggatgaagggcctgaggagccaggagagaagtttcggaggctggcaggcgaaggg
ggtgatccggccttgccccgaccccggctgtatcctgcagctcctgctatgcccagccca
gatgtggtatacggggccttaccgccaccaggctgtgaccccagtgggcttggggaagca
ctgcccgcccagagccgcccatctcccttccgaccagcagcccccaaagccgggccccca
ggcctggtgcaccctctcttctcaccaagccacctcaccagcaagacaccacccccactg
tacctgccgacggaagggcggaggtcagacctgcctggtggcctggctgggccccgaggg
ggactaaacacctccagaagcctctacagtggcctgcagaacccctgctccactgcaact
cccggacccccactggggagcttccccttcctccccggaggccccccagaatatggcctg
ggagaccctccaccgccccctggcttgttgcagccccccaccctggccccctggcagccc
tcgaggggtgatgggccccccgccgtgtcctcccagcccagtgggggccgaagcctgggc
gaggagggtcccccaacccgcggcgcctccccgccgacccccccagtcagcatcaagtct
gagcgcctctctccggcccccgggggccccggcgactttcctaagaccttcccctatccc
ttgctcctcgcccggtccctggcagagcctctgcggcctgggcccgccctgcgccggctg
cccttggccgacggctggccccggtag

DBGET integrated database retrieval system