KEGG   Homo sapiens (human): 100272147
Entry
100272147         CDS       T01001                                 
Symbol
CMC4, C6.1B, MTCP1, MTCP1B, MTCP1NB, p8, p8MTCP1
Name
(RefSeq) C-X9-C motif containing 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MTCP1 NDUF_B7 DUF3583 CHCH
Other DBs
NCBI-GeneID: 100272147
NCBI-ProteinID: NP_001018024
HGNC: 35428
Ensembl: ENSG00000182712
Pharos: P56277(Tdark)
UniProt: P56277
Structure
Position
X:complement(155061622..155071136)
AA seq 68 aa
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEEN
LTRKSASK
NT seq 207 nt   +upstreamnt  +downstreamnt
atgccgcagaaggatccgtgccagaagcaagcctgtgagatacagaaatgtttacaagcc
aacagctacatggaatcaaagtgtcaggctgtcatccaagaactgcgtaagtgttgtgct
cagtatcccaagggaagatctgtcgtctgttcaggatttgaaaaagaagaggaagaaaac
ctaacacggaagtctgcatcaaagtaa

DBGET integrated database retrieval system