KEGG   Homo sapiens (human): 1003
Entry
1003              CDS       T01001                                 

Gene name
CDH5, 7B4, CD144
Definition
(RefSeq) cadherin 5
  KO
K06533  cadherin 5, type 2, VE-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04670  Leukocyte transendothelial migration
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1003 (CDH5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1003 (CDH5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    1003 (CDH5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    1003 (CDH5)
   04090 CD molecules [BR:hsa04090]
    1003 (CDH5)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1003 (CDH5)
CD molecules [BR:hsa04090]
 Proteins
  1003 (CDH5)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_3 Cadherin_2 Stevor
Other DBs
NCBI-GeneID: 1003
NCBI-ProteinID: NP_001786
OMIM: 601120
HGNC: 1764
Ensembl: ENSG00000179776
Vega: OTTHUMG00000137495
Pharos: P33151(Tbio)
UniProt: P33151 Q59EA3
Position
16q21
AA seq 784 aa
MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
NTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
VIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADD
PTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSG
TATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVI
INITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFA
KPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKY
GQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDG
DGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPRE
ELLY
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgcagaggctcatgatgctcctcgccacatcgggcgcctgcctgggcctgctggcagtg
gcagcagtggcagcagcaggtgctaaccctgcccaacgggacacccacagcctgctgccc
acccaccggcgccaaaagagagattggatttggaaccagatgcacattgatgaagagaaa
aacacctcacttccccatcatgtaggcaagatcaagtcaagcgtgagtcgcaagaatgcc
aagtacctgctcaaaggagaatatgtgggcaaggtcttccgggtcgatgcagagacagga
gacgtgttcgccattgagaggctggaccgggagaatatctcagagtaccacctcactgct
gtcattgtggacaaggacactggcgaaaacctggagactccttccagcttcaccatcaaa
gttcatgacgtgaacgacaactggcctgtgttcacgcatcggttgttcaatgcgtccgtg
cctgagtcgtcggctgtggggacctcagtcatctctgtgacagcagtggatgcagacgac
cccactgtgggagaccacgcctctgtcatgtaccaaatcctgaaggggaaagagtatttt
gccatcgataattctggacgtattatcacaataacgaaaagcttggaccgagagaagcag
gccaggtatgagatcgtggtggaagcgcgagatgcccagggcctccggggggactcgggc
acggccaccgtgctggtcactctgcaagacatcaatgacaacttccccttcttcacccag
accaagtacacatttgtcgtgcctgaagacacccgtgtgggcacctctgtgggctctctg
tttgttgaggacccagatgagccccagaaccggatgaccaagtacagcatcttgcggggc
gactaccaggacgctttcaccattgagacaaaccccgcccacaacgagggcatcatcaag
cccatgaagcctctggattatgaatacatccagcaatacagcttcatcgtcgaggccaca
gaccccaccatcgacctccgatacatgagccctcccgcgggaaacagagcccaggtcatt
atcaacatcacagatgtggacgagccccccattttccagcagcctttctaccacttccag
ctgaaggaaaaccagaagaagcctctgattggcacagtgctggccatggaccctgatgcg
gctaggcatagcattggatactccatccgcaggaccagtgacaagggccagttcttccga
gtcacaaaaaagggggacatttacaatgagaaagaactggacagagaagtctacccctgg
tataacctgactgtggaggccaaagaactggattccactggaacccccacaggaaaagaa
tccattgtgcaagtccacattgaagttttggatgagaatgacaatgccccggagtttgcc
aagccctaccagcccaaagtgtgtgagaacgctgtccatggccagctggtcctgcagatc
tccgcaatagacaaggacataacaccacgaaacgtgaagttcaaattcatcttgaatact
gagaacaactttaccctcacggataatcacgataacacggccaacatcacagtcaagtat
gggcagtttgaccgggagcataccaaggtccacttcctacccgtggtcatctcagacaat
gggatgccaagtcgcacgggcaccagcacgctgaccgtggccgtgtgcaagtgcaacgag
cagggcgagttcaccttctgcgaggatatggccgcccaggtgggcgtgagcatccaggca
gtggtagccatcttactctgcatcctcaccatcacagtgatcaccctgctcatcttcctg
cggcggcggctccggaagcaggcccgcgcgcacggcaagagcgtgccggagatccacgag
cagctggtcacctacgacgaggagggcggcggcgagatggacaccaccagctacgatgtg
tcggtgctcaactcggtgcgccgcggcggggccaagcccccgcggcccgcgctggacgcc
cggccttccctctatgcgcaggtgcagaagccaccgaggcacgcgcctggggcacacgga
gggcccggggagatggcagccatgatcgaggtgaagaaggacgaggcggaccacgacggc
gacggccccccctacgacacgctgcacatctacggctacgagggctccgagtccatagcc
gagtccctcagctccctgggcaccgactcatccgactctgacgtggattacgacttcctt
aacgactggggacccaggtttaagatgctggctgagctgtacggctcggacccccgggag
gagctgctgtattag

DBGET integrated database retrieval system