KEGG   Homo sapiens (human): 100302736Help
Entry
100302736         CDS       T01001                                 

Gene name
TMED7-TICAM2, MyD88-4, TICAM-2, TICAM2, TIRAP3, TIRP, TRAM
Definition
(RefSeq) TMED7-TICAM2 readthrough
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L
Motif
Other DBs
NCBI-GeneID: 100302736
NCBI-ProteinID: NP_001157941
HGNC: 33945
Ensembl: ENSG00000251201
Vega: OTTHUMG00000162911
UniProt: Q86XR7 Q9Y3B3 A0A0A6YYA0
Position
5q22.3
AA seq 188 aa AA seqDB search
MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCT
LEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHK
TVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAE
DLNTRVAY
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggccggggtccgcgcagcgctgggcggccgtcgcgggccgttgggggtgcagg
ctgctcgcactgctgctactggtgcctggacccggcggcgcctctgagatcaccttcgag
cttcctgacaacgccaagcagtgcttctacgaggacatcgctcagggcaccaagtgcacc
ctggagttccaggtgattactggtggtcactatgatgtagattgtcgattagaagatcct
gatggtaaagtgttatacaaagagatgaagaaacagtatgatagttttaccttcacagcc
tccaaaaatgggacatacaaattttgcttcagcaatgaattttctactttcacacataaa
actgtatattttgattttcaagttggagaagacccacctttgtttcctagtgagaaccga
gtcagtgctcttacccagatggaatctgcctgtgtttcaattcacgaagctctgaagtct
gtcatcgattatcagactcatttccgtttaagagaagctcaaggccgaagccgagcagag
gatctaaatacaagagtggcctattga

DBGET integrated database retrieval system