KEGG   Homo sapiens (human): 100316904
Entry
100316904         CDS       T01001                                 

Gene name
SAP25
Definition
(RefSeq) Sin3A associated protein 25
  KO
K19193  histone deacetylase complex subunit SAP25
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    100316904 (SAP25)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     100316904 (SAP25)
SSDB
Motif
Pfam: SAP25
Other DBs
NCBI-GeneID: 100316904
NCBI-ProteinID: NP_001335606
HGNC: 41908
Ensembl: ENSG00000205307
Vega: OTTHUMG00000187472
Pharos: Q8TEE9(Tdark)
UniProt: Q8TEE9
Position
7q22.1
AA seq 199 aa
MTPLAPWDPKYEAKAGPRPVWGANCSSGASFSGRTLCHPSFWPLYEAASGRGLRPVAPAT
GHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSLKLLPPPPIMS
ARVLPRPSPSRGPSTAWLSGPELIALTGLLQMSQGEPRPSSSAVGPPDHTSDPPSPCGSP
SSSQGADLSLPQTPDTHCP
NT seq 600 nt   +upstreamnt  +downstreamnt
atgactccactagcgccctgggaccccaagtatgaagccaaagcaggacctcggccggtg
tggggggccaactgtagctcaggagcctcgttctcaggccggacgctgtgtcacccctca
ttctggccgctgtatgaagcagcctcgggcaggggtctcaggcccgtggcccctgccaca
gggcactggaatggacagcaggcgcccccagatgcagggttcccggtggtgtgctgtgaa
gatgtcttcctctcggaccctctgctgccccgggggcagcgtgttcccctgtacctgtcc
aaggccccccagcagatgatgggctccctgaaactgctgccgccgccccccatcatgtct
gccagggtgctcccccgcccatcaccctcccggggcccctccactgcctggctcagcggg
ccggagctgatcgctctcactggcctgctgcagatgagccagggggagcctaggcccagc
tcctccgcggttggccccccagaccatacctctgacccacccagcccctgtggtagcccc
agcagttctcagggtgctgacctctctctcccacagaccccagacacccattgtccatag

DBGET integrated database retrieval system