KEGG   Homo sapiens (human): 10038Help
Entry
10038             CDS       T01001                                 

Gene name
PARP2, ADPRT2, ADPRTL2, ADPRTL3, ARTD2, PARP-2, pADPRT-2
Definition
(RefSeq) poly(ADP-ribose) polymerase 2
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa04210  Apoptosis
hsa04217  Necroptosis
Drug target
Niraparib: D10140
Olaparib: D09730
Pamiparib: D11426
Rucaparib (DG01864): D10079 D10157 D10982
Talazoparib (DG01865): D10732 D10733
Veliparib: D09692
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    10038 (PARP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    10038 (PARP2)
   04217 Necroptosis
    10038 (PARP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    10038 (PARP2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10038 (PARP2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    10038 (PARP2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     10038 (PARP2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     10038 (PARP2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    10038 (PARP2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     10038 (PARP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 10038
NCBI-ProteinID: NP_005475
OMIM: 607725
HGNC: 272
Ensembl: ENSG00000129484
Vega: OTTHUMG00000166106
Pharos: Q9UGN5(Tclin)
UniProt: Q9UGN5
Structure
PDB: 

Position
14q11.2
AA seq 583 aa AA seqDB search
MAARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKD
RTEDKQDGMPGRSWASKRVSESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLN
QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKF
LDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKPESQLDLRVQE
LIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALME
ACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQ
HYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDL
HNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLK
NTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGP
ASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcggcggcgacggagcaccggcggcggcagggcgagagcattaaatgaaagc
aaaagagttaataatggcaacacggctccagaagactcttcccctgccaagaaaactcgt
agatgccagagacaggagtcgaaaaagatgcctgtggctggaggaaaagctaataaggac
aggacagaagacaagcaagatggtatgccaggaaggtcatgggccagcaaaagggtctct
gaatctgtgaaggccttgctgttaaagggcaaagctcctgtggacccagagtgtacagcc
aaggtggggaaggctcatgtgtattgtgaaggaaatgatgtctatgatgtcatgctaaat
cagaccaatctccagttcaacaacaacaagtactatctgattcagctattagaagatgat
gcccagaggaacttcagtgtttggatgagatggggccgagttgggaaaatgggacagcac
agcctggtggcttgttcaggcaatctcaacaaggccaaggaaatctttcagaagaaattc
cttgacaaaacgaaaaacaattgggaagatcgagaaaagtttgagaaggtgcctggaaaa
tatgatatgctacagatggactatgccaccaatactcaggatgaagaggaaacaaagaaa
gaggaatctcttaaatctcccttgaagccagagtcacagctagatcttcgggtacaggag
ttaataaagttgatctgtaatgttcaggccatggaagaaatgatgatggaaatgaagtat
aataccaagaaagccccacttgggaagctgacagtggcacaaatcaaggcaggttaccag
tctcttaagaagattgaggattgtattcgggctggccagcatggacgagctctcatggaa
gcatgcaatgaattctacaccaggattccgcatgactttggactccgtactcctccacta
atccggacacagaaggaactgtcagaaaaaatacaattactagaggctttgggagacatt
gaaattgctattaagctggtgaaaacagagctacaaagcccagaacacccattggaccaa
cactatagaaacctacattgtgccttgcgcccccttgaccatgaaagttatgagttcaaa
gtgatttcccagtacctacaatctacccatgctcccacacacagcgactataccatgacc
ttgctggatttgtttgaagtggagaaggatggtgagaaagaagccttcagagaggacctt
cataacaggatgcttctatggcatggttccaggatgagtaactgggtgggaatcttgagc
catgggcttcgaattgccccacctgaagctcccatcacaggttacatgtttgggaaagga
atctactttgctgacatgtcttccaagagtgccaattactgctttgcctctcgcctaaag
aatacaggactgctgctcttatcagaggtagctctaggtcagtgtaatgaactactagag
gccaatcctaaggccgaaggattgcttcaaggtaaacatagcaccaaggggctgggcaag
atggctcccagttctgcccacttcgtcaccctgaatgggagtacagtgccattaggacca
gcaagtgacacaggaattctgaatccagatggttataccctcaactacaatgaatatatt
gtatataaccccaaccaggtccgtatgcggtaccttttaaaggttcagtttaatttcctt
cagctgtggtga

DBGET integrated database retrieval system