KEGG   Homo sapiens (human): 100423062
Entry
100423062         CDS       T01001                                 

Gene name
IGLL5, IGL, IGLV, VL-MAR
Definition
(RefSeq) immunoglobulin lambda like polypeptide 5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: C1-set C2-set_2 Ig_3 ig Marek_A I-set PTCRA
Other DBs
NCBI-GeneID: 100423062
NCBI-ProteinID: NP_001171597
HGNC: 38476
Ensembl: ENSG00000254709
Vega: OTTHUMG00000165670
Pharos: B9A064(Tdark)
UniProt: B9A064
Structure
PDB: 

Position
22q11.22
AA seq 214 aa
MRPKTGQVGCETPEELGPGPRQRWPLLLLGLAMVAHGLLRPMVAPQSGDPDPGASVGSSR
SSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
NT seq 645 nt   +upstreamnt  +downstreamnt
atgagacccaagacaggccaagtgggttgtgagacccctgaggagctgggccctggtccc
aggcagcgctggcccctgctgctgctgggtctggccatggtcgcccatggcctgctgcgc
ccaatggttgcaccgcaaagcggggacccagaccctggagcctcagttggaagcagccga
tccagcctgcggagcctgtggggcaggctcctgctccagcccagcccccagagagcagac
cccaggtgctggccccgggggttttggtctgagcctcagtcactgtgttatgtcttcgga
actgggaccaaggtcaccgtcctaggtcagcccaaggccaaccccactgtcactctgttc
ccgccctcctctgaggagctccaagccaacaaggccacactagtgtgtctgatcagtgac
ttctacccgggagctgtgacagtggcctggaaggcagatggcagccccgtcaaggcggga
gtggagaccaccaaaccctccaaacagagcaacaacaagtacgcggccagcagctacctg
agcctgacgcccgagcagtggaagtcccacagaagctacagctgccaggtcacgcatgaa
gggagcaccgtggagaagacagtggcccctacagaatgttcatag

DBGET integrated database retrieval system