KEGG   Homo sapiens (human): 10046Help
Entry
10046             CDS       T01001                                 

Gene name
MAMLD1, CG1, CXorf6, F18, HYSP2
Definition
(RefSeq) mastermind like domain containing 1
  KO
K19512  mastermind-like domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Disease
H02175  Hypospadias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    10046 (MAMLD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 10046
NCBI-ProteinID: NP_005482
OMIM: 300120
HGNC: 2568
Ensembl: ENSG00000013619
Vega: OTTHUMG00000024157
Pharos: Q13495(Tbio)
UniProt: Q13495
Position
Xq28
AA seq 774 aa AA seqDB search
MDDWKSRLVIKSMLPHFAMVGNRQEPRKLQESGKKPSWMEEEDLSFLYKSSPGRKHQGTV
KRRQEEDHFQFPDMADGGYPNKIKRPCLEDVTLAMGPGAHPSTACAELQVPPLTINPSPA
AMGVAGQSLLLENNPMNGNIMGSPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELL
EELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSHLESLASSKEFA
SSCSQVTGMSLQIPSSSTGISYSIPSTSKQIVSPSSSMAQSKSQVQAMLPVALPPLPVPQ
WHHAHQLKALAASKQGSATKQQGPTPSWSGLPPPGLSPPYRPVPSPHPPPLPLPPPPPPF
SPQSLMVSCMSSNTLSGSTLRGSPNALLSSMTSSSNAALGPAMPYAPEKLPSPALTQQPQ
FGPQSSILANLMSSTIKTPQGHLMSALPASNPGPSPPYRPEKLSSPGLPQQSFTPQCSLI
RSLTPTSNLLSQQQQQQQQQQQANVIFKPISSNSSKTLSMIMQQGMASSSPGATEPFTFG
NTKPLSHFVSEPGPQKMPSMPTTSRQPSLLHYLQQPTPTQASSATASSTATATLQLQQQQ
QQQQQQPDHSSFLLQQMMQQPQRFQRSVASDSMPALPRQGCCHLFAWTSAASSVKPQHQH
GNSFTSRQDPQPGDVSPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSF
AHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggatgactggaaaagtcggcttgtaatcaagagcatgcttccccatttcgccatggtg
ggaaatcgtcaggagcccagaaagctccaggaatcgggaaagaagccctcgtggatggag
gaagaagatttatcttttctctacaagagcagcccaggaagaaagcatcagggaactgtt
aagaggagacaagaagaagaccacttccagtttccagacatggctgatgggggctaccct
aataaaattaagaggccttgccttgaagatgtcacccttgcaatgggcccaggtgctcat
cctagtactgcttgtgcagaactgcaggtccctccattgacaataaatcctagccctgcg
gctatgggagtggctggccagtcattactgctggagaataaccctatgaatggcaacatc
atgggctcaccatttgtagtaccacagactacagaagtgggactgaaagggcccactgtt
ccttactatgagaaaatcaacagcgtgccggctgtagaccaggagcttcaagagctgcta
gaggagctcaccaaaattcaagacccttctccaaatgagctagatcttgagaagatactg
gggacgaagccagaagagccactggttttagatcatccccaggcaaccctaagcacaact
cccaagccttcggttcagatgtcacacttggagagcctggcttccagcaaggagtttgct
tctagttgcagccaagttactggcatgtcacttcagatcccatcctcctccacagggatc
agctattcgattccttccaccagtaagcagatagtgtcaccgagttcttcaatggcacag
tccaagagccaggtccaggccatgctccctgtcgctctgccccccttaccagtgcctcag
tggcatcacgcccaccagctgaaggcgttggcagccagcaagcaggggtctgctacaaag
cagcaagggcccacccccagttggtctggtctgcctcctccaggactctctccaccttac
cgcccagtgccatcaccacacccaccaccgctgccactgccaccaccaccacccccattc
agcccccagagcctcatggtgtcctgcatgtcgtccaataccttgtcgggtagcactctc
cgaggctctcccaatgccttactgtcaagcatgacgtccagcagcaatgctgccctgggg
cccgccatgccctatgctcctgagaagctccccagccctgctctcactcaacagccgcag
ttcggccctcagagctccattcttgccaacctcatgtcctctaccatcaaaacccctcaa
ggacacctgatgtctgctctgcctgccagcaaccctgggccgtccccaccctatcgccca
gagaagctctctagcccaggcttgccacagcagtccttcaccccacagtgttccctgatc
cgaagcctcactcccaccagtaatcttctaagccagcaacagcagcagcagcagcagcag
cagcaagcaaatgtgatctttaagcccataagcagcaactcatccaaaaccctgagcatg
atcatgcagcaggggatggcaagctccagcccaggagccacggagccatttacttttggc
aacaccaagcccttgtcccattttgtttctgagccgggtccccagaagatgccctccatg
cctaccacctctaggcagccttccctgctccactacctgcagcagccgacaccaacgcag
gcctcctcagccactgcctcctccacggccactgccaccttgcagctgcagcagcagcag
cagcaacagcagcagcagcctgaccattcttcattccttctgcagcagatgatgcagcaa
ccccagcgttttcagcgatcagtggcctcagattccatgcctgctctgcccagacagggc
tgttgccatctgtttgcatggacttctgcagctagctcggtgaagccccagcatcaacac
gggaactctttcactagcaggcaagatcctcagcctggagacgtgtcaccgtctaacatt
actcatgtagacaaagcctgcaagcttggggaagccaggcacccccaggtcagcctcggg
cgacagcccccgtcctgccaggccctggggagtgagtccttcctgcccggcagctccttt
gctcatgagctggcccgagtcacctcctcgtacagcacctcagaggcagcgccctggggc
agctgggatccgaaggcctggaggcaggtgcccgctccactactgcctagctgcgacgcc
acagcaagaggaacagagatcaggtcttatggcaatgacccctga

DBGET integrated database retrieval system