KEGG   Homo sapiens (human): 10049Help
Entry
10049             CDS       T01001                                 

Gene name
DNAJB6, DJ4, DnaJ, HHDJ1, HSJ-2, HSJ2, LGMD1D, LGMD1E, LGMDD1, MRJ, MSJ-1
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B6
  KO
K09512  DnaJ homolog subfamily B member 6
Organism
hsa  Homo sapiens (human)
Disease
H00593  Limb-girdle muscular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10049 (DNAJB6)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   10049 (DNAJB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ
Motif
Other DBs
NCBI-GeneID: 10049
NCBI-ProteinID: NP_490647
OMIM: 611332
HGNC: 14888
Ensembl: ENSG00000105993
Vega: OTTHUMG00000157242
Pharos: O75190(Tbio)
UniProt: O75190
Position
7q36.3
AA seq 326 aa AA seqDB search
MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAK
KRDIYDKYGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFE
DFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSF
GGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEVEEDGQLKSLTINGVADDDALAE
ERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAG
LKEGGKRKKQKQREESKKKKSTKGNH
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtggattactatgaagttctaggcgtgcagagacatgcctcacccgaggatattaaa
aaggcatatcggaaactggcactgaagtggcatccagataaaaatcctgagaataaagaa
gaagcagagagaaaattcaagcaagtagcggaggcatatgaagtgctgtcggatgctaag
aaacgggacatctatgacaaatatggcaaagaaggattaaatggtggaggaggaggtgga
agtcattttgacagtccatttgaatttggcttcacattccgtaacccagatgatgtcttc
agggaattttttggtggaagggacccattttcatttgacttctttgaagacccttttgag
gacttctttgggaatcgaaggggtccccgaggaagcagaagccgagggacggggtcgttt
ttctctgcgttcagtggatttccgtcttttggaagtggattttcttcttttgatacagga
tttacttcatttgggtcactaggtcacgggggcctcacttcattctcttccacgtcattt
ggtggtagtggcatgggcaacttcaaatcgatatcaacttcaactaaaatggttaatggc
agaaaaatcactacaaagagaattgtcgagaacggtcaagaaagagtagaagttgaagaa
gatggccagttaaagtccttaacaataaatggtgtggccgacgacgatgccctcgctgag
gagcgcatgcggagaggccagaacgccctgccagcccagcctgccggcctccgcccgccg
aagccgccccggcctgcctcgctgctgagacacgcgcctcactgtctctctgaggaggag
ggcgagcaggaccgacctcgggcacccgggccctgggaccccctcgcgtccgcagcagga
ttgaaagaaggtggcaagaggaagaagcagaagcagagagaggagtcgaagaagaagaag
tcgaccaaaggcaatcactag

DBGET integrated database retrieval system