KEGG   Homo sapiens (human): 100506012Help
Entry
100506012         CDS       T01001                                 

Gene name
PPP5D1
Definition
(RefSeq) PPP5 tetratricopeptide repeat domain containing 1
  KO
K04460  serine/threonine-protein phosphatase 5 [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100506012 (PPP5D1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    100506012 (PPP5D1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100506012 (PPP5D1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    Catalytic subunits
     100506012 (PPP5D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PPP5
Motif
Other DBs
NCBI-GeneID: 100506012
NCBI-ProteinID: NP_001192210
HGNC: 44209
Ensembl: ENSG00000230510
Vega: OTTHUMG00000183425
Position
19q13.32
AA seq 137 aa AA seqDB search
MAEMRAWRPLVRPSLQCVKLGRATARWWWVVKVKPHDKDAKMKYQECNKIVKQKAFERAI
AGDEHKRSVVDSLDIESMTIEGEYSGPKLEDDKVTITFMKGLMQWYKDQKKLHQKCAYQD
FRQKSGIITSQDCVQTT
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatgagagcttggcgcccattggtccgaccttccctgcaatgcgtcaaactg
gggcgagccactgcaaggtggtggtgggtggtcaaggtgaagccccacgacaaggatgcc
aaaatgaaataccaggagtgcaacaagatcgtgaagcagaaggcctttgagcgggccatc
gcaggcgacgagcacaagcgctccgtggtggactcgctggacatcgagagcatgaccatc
gagggtgagtacagcggacccaagcttgaggacgacaaagtgacaatcaccttcatgaag
gggctcatgcagtggtacaaggaccagaagaaactgcaccagaaatgcgcctaccaggat
ttcagacaaaaatcaggaatcatcaccagccaagactgtgttcagaccacgtga

KEGG   Homo sapiens (human): 5536Help
Entry
5536              CDS       T01001                                 

Gene name
PPP5C, PP5, PPP5, PPT
Definition
(RefSeq) protein phosphatase 5 catalytic subunit
  KO
K04460  serine/threonine-protein phosphatase 5 [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5536 (PPP5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    5536 (PPP5C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5536 (PPP5C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    Catalytic subunits
     5536 (PPP5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos PPP5 TPR_1 TPR_2 TPR_11 TPR_16 TPR_8 TPR_9 TPR_19 TPR_14 TPR_17 TPR_12 TPR_7 MIT AAA_assoc_2
Motif
Other DBs
NCBI-GeneID: 5536
NCBI-ProteinID: NP_006238
OMIM: 600658
HGNC: 9322
Ensembl: ENSG00000011485
Vega: OTTHUMG00000134287
Pharos: P53041(Tbio)
UniProt: P53041 A0A024R0Q7
Structure
PDB: 

Position
19q13.32
AA seq 499 aa AA seqDB search
MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPS
NAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYE
TVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPK
LEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVC
GDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLL
RGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDG
VTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNL
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVP
HPNVKPMAYANTLLQLGMM
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcggagggcgagaggactgagtgtgctgagcccccccgggacgaacccccg
gctgatggagctctgaagcgggcagaggagctcaagactcaggccaatgactacttcaaa
gccaaggactacgagaacgccatcaagttctacagccaggccatcgagctgaaccccagc
aatgccatctactatggcaaccgcagcctggcctacctgcgcactgagtgctatggctac
gcgctgggagacgccacgcgggccattgagctggacaagaagtacatcaagggttattac
cgccgggctgccagcaacatggcactgggcaagttccgggccgcgctgcgagactacgag
acggtggtcaaggtgaagccccatgacaaggatgccaaaatgaaataccaggagtgcaac
aagatcgtgaagcagaaggcctttgagcgggccatcgcgggcgacgagcacaagcgctcc
gtggtggactcgctggacatcgagagcatgaccattgaggatgagtacagcggacccaag
cttgaagacggcaaagtgacaatcagtttcatgaaggagctcatgcagtggtacaaggac
cagaagaaactgcaccggaaatgtgcctaccagattctggtacaggtcaaagaggtcctc
tccaagctgagcacgctcgtggaaaccacactcaaagagacagagaagattacagtatgt
ggggacacccatggccagttctatgacctcctcaacatattcgagctcaacggtttaccc
tcggagaccaacccctatatatttaatggtgactttgtggaccgaggctccttctctgta
gaagtgatcctcacccttttcggcttcaagctcctgtacccagatcactttcacctcctt
cgaggcaaccacgagacagacaacatgaaccagatctacggtttcgagggtgaggtgaag
gccaagtacacagcccagatgtacgagctctttagcgaggtgttcgagtggctcccgttg
gcccagtgcatcaacggcaaagtgctgatcatgcacggaggcctgttcagtgaagacggt
gtcaccctggatgacatccggaaaattgagcggaatcgacaacccccagattcagggccc
atgtgtgacctgctctggtcagatccacagccacagaacgggcgctcgatcagcaagcgg
ggcgtgagctgtcagtttgggcctgacgtcaccaaggccttcttggaagagaacaacctg
gactatatcatccgcagccacgaagtcaaggccgagggctacgaggtggctcacggaggc
cgctgtgtcaccgtcttctctgcccccaactactgcgaccagatggggaacaaagcctcc
tacatccacctccagggctctgacctacggcctcagttccaccagttcacagcagtgcct
catcccaacgtcaagcccatggcctatgccaacacgctgctgcagctaggaatgatgtga

DBGET integrated database retrieval system