KEGG   Homo sapiens (human): 100506742Help
Entry
100506742         CDS       T01001                                 

Gene name
CASP12, CASP-12, CASP12P1
Definition
(RefSeq) caspase 12 (gene/pseudogene)
  KO
K04741  caspase 12 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04621  NOD-like receptor signaling pathway
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05020  Prion diseases
hsa05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100506742 (CASP12)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100506742 (CASP12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100506742 (CASP12)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    100506742 (CASP12)
   05014 Amyotrophic lateral sclerosis (ALS)
    100506742 (CASP12)
   05020 Prion diseases
    100506742 (CASP12)
  09167 Infectious diseases
   05161 Hepatitis B
    100506742 (CASP12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    100506742 (CASP12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     100506742 (CASP12)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   100506742 (CASP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD
Motif
Other DBs
NCBI-GeneID: 100506742
NCBI-ProteinID: NP_001177945
OMIM: 608633
HGNC: 19004
Ensembl: ENSG00000204403
Vega: OTTHUMG00000154965
Pharos: Q6UXS9(Tbio)
UniProt: Q6UXS9
Position
11q22.3
AA seq 341 aa AA seqDB search
MADEKPSNGVLVHMVKLLIKTFLDGIFDDLMENNVLNTDEIHLIGKCLKFVVSNAENLVD
DITETAQIAGKIFREHLWNSKKQLSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELD
LLGMRDLLENLGYSVVIKENLTAQEMETALRQFAAHPEHQSSDSTFLVFMSHSILNGICG
TKHWDQEPDVLHDDTIFEIFNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASAD
THGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS
HHLEEIFQKVQHSFETPNILTQLPTIERLSMTRYFYLFPGN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgagaaaccatccaacggtgttctggtccacatggtgaagttgctgatcaag
acctttctagatggcatttttgatgatttgatggaaaataatgtgttaaatacagatgag
atacaccttataggaaaatgtctaaagtttgtggtgagcaatgctgaaaacctggttgat
gatatcactgagacagctcaaattgcaggcaaaatatttagggaacacctgtggaattcc
aaaaaacagctgagttcagatatatccagtgatggagaaagagaggcgaacatgcctggc
ctcaacatccgcaacaaagaattcaactatcttcataatcgaaatggttctgaacttgac
cttttggggatgcgagatctacttgaaaaccttggatactcagtggttataaaagagaat
ctcacagctcaggaaatggaaacagcactaaggcagtttgctgctcacccagagcaccag
tcctcagacagcacattcctggtgtttatgtcacatagcatcctgaatggaatctgtggg
accaagcactgggatcaagagccagatgttcttcacgatgacaccatctttgaaattttc
aacaaccgtaactgccagagtctgaaagacaaacccaaggtcatcatcatgcaagcctgc
cgaggcaatggtgctgggattgtttggttcaccactgacagtggaaaagccagtgcagat
actcatggtcggctcttgcaaggtaacatctgtaatgatgctgttacaaaggctcatgtg
gaaaaggacttcattgctttcaaatcttccacaccacataatgtttcttggagacatgaa
acaaatggctctgtcttcatttcccaaattatctactacttcagagagtattcttggagt
catcatctagaggaaatttttcaaaaggttcaacattcatttgagaccccaaatatactg
acccagctgcccaccattgaaagactatccatgacacgatatttctatctctttcctggg
aattaa

DBGET integrated database retrieval system