KEGG   Homo sapiens (human): 100507608Help
Entry
100507608         CDS       T01001                                 

Gene name
KRTAP9-6, KAP9.6, KRTAP9.6, KRTAP9L2
Definition
(RefSeq) keratin associated protein 9-6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_B2_2 Keratin_B2
Motif
Other DBs
NCBI-GeneID: 100507608
NCBI-ProteinID: NP_001264260
HGNC: 18914
Ensembl: ENSG00000212659
Vega: OTTHUMG00000133600
Pharos: A8MVA2(Tdark)
UniProt: A8MVA2
Position
17q21.2
AA seq 160 aa AA seqDB search
MTHCCSPGCQPTCCRTTCCRTTCWQPTIVTTCSSTPCCQPSCCVSSCCQPYCHPTCCQNT
CCRTTCCQPTCVTSCCQPSCCSTPCYQPICCGSSCCGQTSCGSSCGQSSSCAPVYCRRTC
YHPTTVCLPGCLNQSCGSSCCQPCYCPACCVSSCCQHSCC
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacccactgttgctcccctggctgtcagcctacctgctgcaggaccacttgctgcagg
actacctgctggcagcccaccattgtgaccacctgcagcagcacaccctgctgccagccc
tcctgctgtgtgtccagctgctgccagccttactgccacccaacttgctgtcaaaacacc
tgctgcaggaccacctgctgccagcccacctgtgtgaccagctgctgccagccttcctgc
tgcagcacaccctgctaccagcccatctgctgtgggtccagctgctgtggccaaaccagc
tgtgggtccagctgtggccagagcagctcctgtgcacctgtgtactgcagaagaacctgc
taccaccccacgactgtctgcctgcctggttgcctcaaccagagctgtggatccagctgc
tgccagccctgctactgcccagcctgctgtgtgtccagctgctgccagcattcttgttgc
tga

DBGET integrated database retrieval system