KEGG   Homo sapiens (human): 100526767Help
Entry
100526767         CDS       T01001                                 

Gene name
RNF103-CHMP3, CGI149, CHMP3, NEDF, RNF103-VPS24, VPS24, hVps24
Definition
(RefSeq) RNF103-CHMP3 readthrough
  KO
K12193  charged multivesicular body protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100526767 (RNF103-CHMP3)
  09143 Cell growth and death
   04217 Necroptosis
    100526767 (RNF103-CHMP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    100526767 (RNF103-CHMP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    100526767 (RNF103-CHMP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100526767 (RNF103-CHMP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100526767 (RNF103-CHMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 zf-ZPR1 AAA_6 DUF3915
Motif
Other DBs
NCBI-GeneID: 100526767
NCBI-ProteinID: NP_001185883
HGNC: 38847
Ensembl: ENSG00000249884
Vega: OTTHUMG00000160822
UniProt: Q9Y3E7
Structure
PDB: 

Position
2p11.2
AA seq 251 aa AA seqDB search
MEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWLVQVNEWSLKIRKEMRVVD
RQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGM
KNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESM
DDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALE
AMQSRLATLRS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgagctctattctgctctcaaggaagaagaagcatccgaatcggtttctagt
accaatttcagtggtgaaatgcacttctatgagcttgtggaagacacaaaagatggcatc
tggctggttcaggtcaatgagtggtcattgaagataagaaaggaaatgagagttgttgac
aggcaaataagggatatccaaagagaagaagaaaaagtgaaacgatctgtgaaagatgct
gccaagaagggccagaaggatgtctgcatagttctggccaaggagatgatcaggtcaagg
aaggctgtgagcaagctgtatgcatccaaagcacacatgaactcagtgctcatggggatg
aagaaccagctcgcggtcttgcgagtggctggttccctgcagaagagcacagaagtgatg
aaggccatgcaaagtcttgtgaagattccagagattcaggccaccatgagggagttgtcc
aaagaaatgatgaaggctgggatcatagaggagatgttagaggacacttttgaaagcatg
gacgatcaggaagaaatggaggaagaagcagaaatggaaattgacagaattctctttgaa
attacagcaggggccttgggcaaagcacccagtaaagtgactgatgcccttccagagcca
gaacctccaggagcgatggctgcctcagaggatgaggaggaggaggaagaggctctggag
gccatgcagtcccggctggccacactccgcagctag

DBGET integrated database retrieval system