KEGG   Homo sapiens (human): 100526767Help
Entry
100526767         CDS       T01001                                 

Gene name
RNF103-CHMP3, CGI149, CHMP3, NEDF, RNF103-VPS24, VPS24, hVps24
Definition
(RefSeq) RNF103-CHMP3 readthrough
  KO
K12193  charged multivesicular body protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100526767 (RNF103-CHMP3)
  09143 Cell growth and death
   04217 Necroptosis
    100526767 (RNF103-CHMP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    100526767 (RNF103-CHMP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    100526767 (RNF103-CHMP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100526767 (RNF103-CHMP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100526767 (RNF103-CHMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 zf-ZPR1 AAA_6 DUF3915
Motif
Other DBs
NCBI-GeneID: 100526767
NCBI-ProteinID: NP_001185883
HGNC: 38847
Ensembl: ENSG00000249884
Vega: OTTHUMG00000160822
UniProt: Q9Y3E7
Structure
PDB: 

Position
2p11.2
AA seq 251 aa AA seqDB search
MEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWLVQVNEWSLKIRKEMRVVD
RQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGM
KNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESM
DDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALE
AMQSRLATLRS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgagctctattctgctctcaaggaagaagaagcatccgaatcggtttctagt
accaatttcagtggtgaaatgcacttctatgagcttgtggaagacacaaaagatggcatc
tggctggttcaggtcaatgagtggtcattgaagataagaaaggaaatgagagttgttgac
aggcaaataagggatatccaaagagaagaagaaaaagtgaaacgatctgtgaaagatgct
gccaagaagggccagaaggatgtctgcatagttctggccaaggagatgatcaggtcaagg
aaggctgtgagcaagctgtatgcatccaaagcacacatgaactcagtgctcatggggatg
aagaaccagctcgcggtcttgcgagtggctggttccctgcagaagagcacagaagtgatg
aaggccatgcaaagtcttgtgaagattccagagattcaggccaccatgagggagttgtcc
aaagaaatgatgaaggctgggatcatagaggagatgttagaggacacttttgaaagcatg
gacgatcaggaagaaatggaggaagaagcagaaatggaaattgacagaattctctttgaa
attacagcaggggccttgggcaaagcacccagtaaagtgactgatgcccttccagagcca
gaacctccaggagcgatggctgcctcagaggatgaggaggaggaggaagaggctctggag
gccatgcagtcccggctggccacactccgcagctag

KEGG   Homo sapiens (human): 128866Help
Entry
128866            CDS       T01001                                 

Gene name
CHMP4B, C20orf178, CHMP4A, CTPP3, CTRCT31, SNF7, SNF7-2, Shax1, VPS32B, Vps32-2, dJ553F4.4
Definition
(RefSeq) charged multivesicular body protein 4B
  KO
K12194  charged multivesicular body protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Disease
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    128866 (CHMP4B)
  09143 Cell growth and death
   04217 Necroptosis
    128866 (CHMP4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    128866 (CHMP4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    128866 (CHMP4B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    128866 (CHMP4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128866 (CHMP4B)
  Exosomal proteins of other body fluids (saliva and urine)
   128866 (CHMP4B)
  Exosomal proteins of colorectal cancer cells
   128866 (CHMP4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 SYF2 WD-3 Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 128866
NCBI-ProteinID: NP_789782
OMIM: 610897
HGNC: 16171
Ensembl: ENSG00000101421
Vega: OTTHUMG00000032272
Pharos: Q9H444(Tbio)
UniProt: Q9H444
Structure
PDB: 

Position
20q11.22
AA seq 224 aa AA seqDB search
MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTK
NKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
DNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNL
LEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgttcgggaagctgttcggggctggagggggtaaggccggcaagggcggcccg
accccccaggaggccatccagcggctgcgggacacggaagagatgttaagcaagaaacag
gagttcctggagaagaaaatcgagcaggagctgacggccgccaagaagcacggcaccaaa
aacaagcgcgcggccctccaggcactgaagcgtaagaagaggtatgagaagcagctggcg
cagatcgacggcacattatcaaccatcgagttccagcgggaggccctggagaatgccaac
accaacaccgaggtgctcaagaacatgggctatgccgccaaggccatgaaggcggcccat
gacaacatggacatcgataaagttgatgagttaatgcaggacattgctgaccagcaagaa
cttgcagaggagatttcaacagcaatttcgaaacctgtagggtttggagaagagtttgac
gaggatgagctcatggcggaattagaagaactagaacaggaggaactagacaagaatttg
ctggaaatcagtggacccgaaacagtccctctaccaaatgttccctctatagccctacca
tcaaaacccgccaagaagaaagaagaggaggacgacgacatgaaggaattggagaactgg
gctggatccatgtaa

KEGG   Homo sapiens (human): 25978Help
Entry
25978             CDS       T01001                                 

Gene name
CHMP2B, ALS17, CHMP2.5, DMT1, VPS2-2, VPS2B
Definition
(RefSeq) charged multivesicular body protein 2B
  KO
K12192  charged multivesicular body protein 2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00078  Frontotemporal lobar degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25978 (CHMP2B)
  09143 Cell growth and death
   04217 Necroptosis
    25978 (CHMP2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    25978 (CHMP2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    25978 (CHMP2B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    25978 (CHMP2B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25978 (CHMP2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 DnaJ-X
Motif
Other DBs
NCBI-GeneID: 25978
NCBI-ProteinID: NP_054762
OMIM: 609512
HGNC: 24537
Ensembl: ENSG00000083937
Vega: OTTHUMG00000158982
Pharos: Q9UQN3(Tbio)
UniProt: Q9UQN3 B2RE76
Position
3p11.2
AA seq 213 aa AA seqDB search
MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKV
LAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQK
TLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAK
APSAARSLPSASTSKATISDEEIERQLKALGVD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctcttcaagaagaaaaccgtggatgatgtaataaaggaacagaatcgagag
ttacgaggtacacagagggctataatcagagatcgagcagctttagagaaacaagaaaaa
cagctggaattagaaattaagaaaatggccaagattggtaataaggaagcttgcaaagtt
ttagccaaacaacttgtgcatctacggaaacagaagacgagaacttttgctgtaagttca
aaagttacttctatgtctacacaaacaaaagtgatgaattcccaaatgaagatggctgga
gcaatgtctactacagcaaaaacaatgcaggcagttaacaagaagatggatccacaaaag
acattacaaacaatgcagaatttccagaaggaaaacatgaaaatggaaatgactgaagaa
atgatcaatgatacacttgatgacatctttgacggttctgatgacgaagaagaaagccag
gatattgtgaatcaagttcttgatgaaattggaattgaaatttctggaaagatggccaaa
gctccatcagctgctcgaagcttaccatctgcctctacttcaaaggctacaatctcagat
gaagagattgaacggcaactcaaggctttaggagtagattag

KEGG   Homo sapiens (human): 27183Help
Entry
27183             CDS       T01001                                 

Gene name
VPS4A, SKD1, SKD1A, SKD2, VPS4, VPS4-1
Definition
(RefSeq) vacuolar protein sorting 4 homolog A
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    27183 (VPS4A)
  09143 Cell growth and death
   04217 Necroptosis
    27183 (VPS4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27183 (VPS4A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    27183 (VPS4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 TIP49 IstB_IS21 AAA_22 AAA_16 RuvB_N AAA_14 AAA_5 DUF815 AAA_18 AAA_2 AAA_33 RNA_helicase AAA_17 AAA_24 PhoH AAA_7 NACHT Mg_chelatase Sigma54_activat YhdB YCII AAA_30 Sigma54_activ_2 MCM
Motif
Other DBs
NCBI-GeneID: 27183
NCBI-ProteinID: NP_037377
OMIM: 609982
HGNC: 13488
Ensembl: ENSG00000132612
Vega: OTTHUMG00000175589
Pharos: Q9UN37(Tbio)
UniProt: Q9UN37 A0A024R705
Structure
PDB: 

Position
16q22.1
AA seq 437 aa AA seqDB search
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKC
VQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVME
KPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAV
ATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENE
SEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARA
QMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCG
PSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA
DDLLKVKKFSEDFGQES
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgtcaaccctccagaaagccattgatctggtgacgaaagccacagaggaggac
aaagccaagaactacgaggaggcgctgcggctgtaccagcatgcggtggagtacttcctc
cacgctatcaagtatgaggcccacagcgacaaggccaaggagagcattcgagccaagtgc
gtgcagtacctagaccgggccgagaagctgaaggattatttacgaagcaaagagaaacac
ggcaagaagccagtcaaagagaaccagagtgagggcaagggcagtgacagtgacagtgaa
ggggataatccggagaaaaagaaactgcaagaacagctgatgggtgccgtcgtgatggag
aagcccaacatacggtggaacgacgtggccgggctggagggggccaaggaggccctcaaa
gaagctgtcattttgccaatcaaattcccacacttgttcacaggcaagcgcaccccctgg
cgggggattctgctgttcggaccccctggcacagggaaatcctacctggccaaagccgtg
gcaacagaggccaacaactccaccttcttctctgtgtcctcctcagatctgatgtccaag
tggctgggggagagtgaaaagctggtcaagaacctgtttgagctggccaggcagcacaag
ccctccatcatcttcatcgatgaggtggattccctctgcgggtcccgaaatgaaaatgag
agtgaggccgcccggaggatcaaaacggagttcttggtccagatgcagggggtggggaat
aacaatgatgggactctggttcttggagccacaaacatcccatgggtgttggattcggcc
atcaggaggaggtttgaaaaacgaatttatatccccttgccggaggaagctgcccgcgcc
cagatgttccggttgcatctcgggagcactccccacaacctcacggatgcaaacatccac
gagctggcccggaagacggaaggctactcgggcgcggacatcagcatcatcgtgcgggac
tctctcatgcagcccgtgaggaaggtgcagtcggccacacacttcaaaaaggtctgtggc
ccctctcgcaccaaccccagcatgatgattgatgacctcctgactccatgctcaccaggg
gacccaggagccatggagatgacttggatggatgtccctggggacaaactcttagagcct
gtggtttgcatgtcggacatgctgcggtctctggccaccacccggcccacggtgaatgca
gacgacctcctgaaagtgaagaaattctcagaggactttgggcaagagagttaa

KEGG   Homo sapiens (human): 27243Help
Entry
27243             CDS       T01001                                 

Gene name
CHMP2A, BC-2, BC2, CHMP2, VPS2, VPS2A
Definition
(RefSeq) charged multivesicular body protein 2A
  KO
K12191  charged multivesicular body protein 2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    27243 (CHMP2A)
  09143 Cell growth and death
   04217 Necroptosis
    27243 (CHMP2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27243 (CHMP2A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    27243 (CHMP2A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    27243 (CHMP2A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   27243 (CHMP2A)
  Exosomal proteins of other body fluids (saliva and urine)
   27243 (CHMP2A)
  Exosomal proteins of colorectal cancer cells
   27243 (CHMP2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 DUF2570 YlqD
Motif
Other DBs
NCBI-GeneID: 27243
NCBI-ProteinID: NP_055268
OMIM: 610893
HGNC: 30216
Ensembl: ENSG00000130724
Vega: OTTHUMG00000183547
Pharos: O43633(Tbio)
UniProt: O43633 A0A024R4S0
Position
19q13.43
AA seq 222 aa AA seqDB search
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVR
IMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLP
QIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELS
NLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggacctattgttcgggcgccggaagacgccagaggagctactgcggcagaaccagagg
gccctgaaccgtgccatgcgggagctggaccgcgagcgacagaaactagagacccaggag
aagaaaatcattgcagacattaagaagatggccaagcaaggccagatggatgctgttcgc
atcatggcaaaagacttggtgcgcacccggcgctatgtgcgcaagtttgtattgatgcgg
gccaacatccaggctgtgtccctcaagatccagacactcaagtccaacaactcgatggca
caagccatgaagggtgtcaccaaggccatgggcaccatgaacagacagctgaagttgccc
cagatccagaagatcatgatggagtttgagcggcaggcagagatcatggatatgaaggag
gagatgatgaatgatgccattgatgatgccatgggtgatgaggaagatgaagaggagagt
gatgctgtggtgtcccaggttctggatgagctgggacttagcctaacagatgagctgtcg
aacctcccctcaactgggggctcgcttagtgtggctgctggtgggaaaaaagcagaggcc
gcagcctcagccctagctgatgctgatgcagacctggaggaacggcttaagaacctgcgg
agggactga

KEGG   Homo sapiens (human): 29082Help
Entry
29082             CDS       T01001                                 

Gene name
CHMP4A, C14orf123, CHMP4, CHMP4B, HSPC134, SHAX2, SNF7, SNF7-1, VPS32-1, VPS32A
Definition
(RefSeq) charged multivesicular body protein 4A
  KO
K12194  charged multivesicular body protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29082 (CHMP4A)
  09143 Cell growth and death
   04217 Necroptosis
    29082 (CHMP4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29082 (CHMP4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    29082 (CHMP4A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    29082 (CHMP4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29082 (CHMP4A)
  Exosomal proteins of other body fluids (saliva and urine)
   29082 (CHMP4A)
  Exosomal proteins of colorectal cancer cells
   29082 (CHMP4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 GHL5 Ribonuc_2-5A
Motif
Other DBs
NCBI-GeneID: 29082
NCBI-ProteinID: NP_054888
OMIM: 610051
HGNC: 20274
Ensembl: ENSG00000254505
Vega: OTTHUMG00000167036
Pharos: Q9BY43(Tbio)
UniProt: Q9BY43
Position
14q12
AA seq 222 aa AA seqDB search
MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKR
AALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDM
DIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNV
GDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtctcggcaggctcttcgggaaggggaagaaggagaaagggccaacccctgaa
gaagcaatacagaaactgaaggagacagagaagatactgatcaagaaacaggaatttttg
gagcagaagattcaacaggagctacaaacagccaagaagtatgggaccaagaataagaga
gctgccctacaggctttgcggaggaagaaaagattcgaacagcagctggcacaaactgac
gggacattatccaccctggagtttcagcgtgaggccattgagaatgccactaccaatgca
gaagtccttcgtaccatggagcttgctgcccaaagcatgaagaaggcctaccaggacatg
gacattgacaaggtagatgaactgatgactgacatcacggaacaacaggaggtggcccag
cagatctcagatgccatttctcggcctatgggctttggagatgatgtggatgaggatgaa
ctgctggaggagctagaggagctggagcaggaggaattggcccaggagttgttaaatgtg
ggcgacaaggaagaagaaccctcagtcaaattgcctagtgtaccttctactcatctgccg
gcagggccagctcccaaagtggatgaagatgaagaagcactaaagcagttggctgagtgg
gtatcctga

KEGG   Homo sapiens (human): 5119Help
Entry
5119              CDS       T01001                                 

Gene name
CHMP1A, CHMP1, PCH8, PCOLN3, PRSM1, VPS46-1, VPS46A
Definition
(RefSeq) charged multivesicular body protein 1A
  KO
K12197  charged multivesicular body protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Disease
H00897  Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5119 (CHMP1A)
  09143 Cell growth and death
   04217 Necroptosis
    5119 (CHMP1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5119 (CHMP1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5119 (CHMP1A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    5119 (CHMP1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5119 (CHMP1A)
  Exosomal proteins of other body fluids (saliva and urine)
   5119 (CHMP1A)
  Exosomal proteins of colorectal cancer cells
   5119 (CHMP1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 MS_channel Ist1 DMSP_lyase
Motif
Other DBs
NCBI-GeneID: 5119
NCBI-ProteinID: NP_002759
OMIM: 164010
HGNC: 8740
Ensembl: ENSG00000131165
Vega: OTTHUMG00000169521
Pharos: Q9HD42(Tbio)
UniProt: Q9HD42
Position
16q24.3
AA seq 196 aa AA seqDB search
MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGV
NWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQ
NLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSV
RSQEDQLSRRLAALRN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggacgataccctgttccagttgaagttcacggcgaagcagctggagaagctggccaag
aaggcggagaaggactccaaggcggagcaggccaaagtgaagaaggcccttctgcagaaa
aatgtagagtgtgcccgtgtgtatgccgagaacgccatccgcaagaagaacgaaggtgtg
aactggcttcggatggcgtcccgcgtagacgcagtggcctccaaggtgcagacagctgtg
actatgaagggggtgaccaagaatatggcccaggtgaccaaagccctggacaaggccctg
agcaccatggacctgcagaaggtctcctcagtgatggacaggttcgagcagcaggtgcag
aacctggacgtccatacatcggtgatggaggactccatgagctcggccaccaccctgacc
acgccgcaggagcaggtggacagcctcatcatgcagatcgccgaggagaatggcctggag
gtgctggaccagctcagccagctgcccgagggcgcctctgccgtgggcgagagctctgtg
cgcagccaggaggaccagctgtcacggaggttggccgccttgaggaactag

KEGG   Homo sapiens (human): 51510Help
Entry
51510             CDS       T01001                                 

Gene name
CHMP5, C9orf83, CGI-34, HSPC177, PNAS-2, SNF7DC2, Vps60
Definition
(RefSeq) charged multivesicular body protein 5
  KO
K12198  charged multivesicular body protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51510 (CHMP5)
  09143 Cell growth and death
   04217 Necroptosis
    51510 (CHMP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51510 (CHMP5)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    51510 (CHMP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 NPV_P10 Prefoldin_2 Spc7 Alpha-E DUF948 BCDHK_Adom3 DUF848
Motif
Other DBs
NCBI-GeneID: 51510
NCBI-ProteinID: NP_057494
OMIM: 610900
HGNC: 26942
Ensembl: ENSG00000086065
Vega: OTTHUMG00000019765
Pharos: Q9NZZ3(Tbio)
UniProt: Q9NZZ3
Structure
PDB: 

Position
9p13.3
AA seq 219 aa AA seqDB search
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNM
VKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAY
KQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDS
SYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgactcttcgggaaagcgaaacccaaggctccgccgcccagcctgactgactgc
attggcacggtggacagtagagcagaatccattgacaagaagatttctcgattggatgct
gagctagtgaagtataaggatcagatcaagaagatgagagagggtcctgcaaagaatatg
gtcaagcagaaagccttgcgagttttaaagcaaaagaggatgtatgagcagcagcgggac
aatcttgcccaacagtcattcaacatggaacaagccaattataccatccagtctttgaag
gacaccaagaccacggttgatgctatgaaactgggagtaaaggaaatgaagaaggcatac
aagcaagtgaagatcgaccagattgaggatttacaagaccagctagaggatatgatggaa
gatgcaaatgaaatccaagaagcactgagtcgcagttatggcaccccagaactggatgaa
gatgatttagaagcagagttggatgcactaggtgatgagcttctggctgatgaagacagt
tcttatttggatgaggcagcatctgcacctgcaattccagaaggtgttcccactgataca
aaaaacaaggatggagttctggtggatgaatttggattgccacagatccctgcttcatag

KEGG   Homo sapiens (human): 51652Help
Entry
51652             CDS       T01001                                 

Gene name
CHMP3, CGI-149, NEDF, VPS24
Definition
(RefSeq) charged multivesicular body protein 3
  KO
K12193  charged multivesicular body protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51652 (CHMP3)
  09143 Cell growth and death
   04217 Necroptosis
    51652 (CHMP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51652 (CHMP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51652 (CHMP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    51652 (CHMP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   51652 (CHMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 zf-ZPR1 AAA_6 DUF3915
Motif
Other DBs
NCBI-GeneID: 51652
NCBI-ProteinID: NP_057163
OMIM: 610052
HGNC: 29865
Ensembl: ENSG00000115561
Vega: OTTHUMG00000153189
Pharos: Q9Y3E7(Tbio)
UniProt: Q9Y3E7
Structure
PDB: 

Position
2p11.2
AA seq 222 aa AA seqDB search
MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVC
IVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKI
PEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKA
PSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggggctgtttggaaagacccaggagaagccgcccaaagaactggtcaatgagtggtca
ttgaagataagaaaggaaatgagagttgttgacaggcaaataagggatatccaaagagaa
gaagaaaaagtgaaacgatctgtgaaagatgctgccaagaagggccagaaggatgtctgc
atagttctggccaaggagatgatcaggtcaaggaaggctgtgagcaagctgtatgcatcc
aaagcacacatgaactcagtgctcatggggatgaagaaccagctcgcggtcttgcgagtg
gctggttccctgcagaagagcacagaagtgatgaaggccatgcaaagtcttgtgaagatt
ccagagattcaggccaccatgagggagttgtccaaagaaatgatgaaggctgggatcata
gaggagatgttagaggacacttttgaaagcatggacgatcaggaagaaatggaggaagaa
gcagaaatggaaattgacagaattctctttgaaattacagcaggggccttgggcaaagca
cccagtaaagtgactgatgcccttccagagccagaacctccaggagcgatggctgcctca
gaggatgaggaggaggaggaagaggctctggaggccatgcagtcccggctggccacactc
cgcagctag

KEGG   Homo sapiens (human): 57132Help
Entry
57132             CDS       T01001                                 

Gene name
CHMP1B, C10orf2, C18-ORF2, C18orf2, CHMP1.5, Vps46-2, Vps46B, hVps46-2
Definition
(RefSeq) charged multivesicular body protein 1B
  KO
K12197  charged multivesicular body protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    57132 (CHMP1B)
  09143 Cell growth and death
   04217 Necroptosis
    57132 (CHMP1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57132 (CHMP1B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    57132 (CHMP1B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    57132 (CHMP1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   57132 (CHMP1B)
  Exosomal proteins of other body fluids (saliva and urine)
   57132 (CHMP1B)
  Exosomal proteins of colorectal cancer cells
   57132 (CHMP1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 Ist1 FlxA DMSP_lyase Mu-like_Pro Mt_ATP-synt_D DUF948
Motif
Other DBs
NCBI-GeneID: 57132
NCBI-ProteinID: NP_065145
OMIM: 606486
HGNC: 24287
Ensembl: ENSG00000255112
Vega: OTTHUMG00000165820
Pharos: Q7LBR1(Tbio)
UniProt: Q7LBR1
Structure
PDB: 

Position
18p11.21
AA seq 199 aa AA seqDB search
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacatggagaaacacctgttcaacctgaagttcgcggccaaagaactgagtagg
agtgccaaaaaatgcgataaggaggaaaaggccgaaaaggccaaaattaaaaaggccatt
cagaagggcaacatggaagttgcgaggatacacgccgaaaatgccatccgccagaagaac
caggcggtgaatttcttgagaatgagtgcgcgagtcgatgcagtggctgccagggtccag
acggcggtgacgatgggcaaggtgaccaagtcgatggctggtgtggttaagtcgatggat
gcgacattgaagaccatgaatctggagaagatttctgctttgatggacaaattcgagcac
cagtttgagactctggacgtccagacgcagcaaatggaagacacgatgagcagcacgacg
acgctcaccactccccagaaccaagtggatatgctgctccaggaaatggcagatgaggcg
ggcctcgacctcaacatggagctgccgcagggccagaccggctccgtgggcacgagcgtg
gcttcggcggagcaggatgaactgtctcagagactggcccgccttcgggatcaagtgtga

KEGG   Homo sapiens (human): 79643Help
Entry
79643             CDS       T01001                                 

Gene name
CHMP6, VPS20
Definition
(RefSeq) charged multivesicular body protein 6
  KO
K12195  charged multivesicular body protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    79643 (CHMP6)
  09143 Cell growth and death
   04217 Necroptosis
    79643 (CHMP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79643 (CHMP6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    79643 (CHMP6)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    79643 (CHMP6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   79643 (CHMP6)
  Exosomal proteins of other body fluids (saliva and urine)
   79643 (CHMP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 Peptidase_S46 Het-C
Motif
Other DBs
NCBI-GeneID: 79643
NCBI-ProteinID: NP_078867
OMIM: 610901
HGNC: 25675
Ensembl: ENSG00000176108
Vega: OTTHUMG00000177645
Pharos: Q96FZ7(Tbio)
UniProt: Q96FZ7
Structure
PDB: 

Position
17q25.3
AA seq 201 aa AA seqDB search
MGNLFGRKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERA
KLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKVMEGLQFGNECLNKMHQVMSI
EEVERILDETQEAVEYQRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPE
KIPENVPVKARPRQAELVAAS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacctgttcggccgcaagaagcagagccgcgtcacggagcaggacaaggccatc
ctgcaactgaagcagcagcgggacaagctgaggcagtaccagaagaggatcgcccagcag
ctggagcgcgagcgcgccctggcccggcagctgctgcgggacggcaggaaggaacgggcc
aagctgctgctcaagaagaagcgataccaggagcagctcctggacaggacggagaaccag
atcagcagcctggaggccatggttcagagtattgagttcacccagatcgaaatgaaagtg
atggaggggctgcagtttggaaatgagtgtctgaacaagatgcaccaggtgatgtccatt
gaagaggtggagaggatcctggacgagacgcaggaggccgtggagtaccagcggcaaata
gacgagctcctggcaggaagcttcactcaggaggatgaagacgccatcctggaggagctg
agcgcaatcactcaggaacaaatagagctgccagaggttccctccgagccccttcctgag
aagatcccagaaaacgtccctgtcaaggccaggcccaggcaggcggagctggtggcagct
tcgtaa

KEGG   Homo sapiens (human): 91782Help
Entry
91782             CDS       T01001                                 

Gene name
CHMP7
Definition
(RefSeq) charged multivesicular body protein 7
  KO
K15053  charged multivesicular body protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    91782 (CHMP7)
  09143 Cell growth and death
   04217 Necroptosis
    91782 (CHMP7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    91782 (CHMP7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    91782 (CHMP7)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    91782 (CHMP7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   91782 (CHMP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 PspA_IM30 LPP Zea_mays_MuDR FapA Fez1
Motif
Other DBs
NCBI-GeneID: 91782
NCBI-ProteinID: NP_689485
OMIM: 611130
HGNC: 28439
Ensembl: ENSG00000147457
Vega: OTTHUMG00000131785
Pharos: Q8WUX9(Tbio)
UniProt: Q8WUX9 B3KUH0
Position
8p21.3
AA seq 453 aa AA seqDB search
MWSPEREAEAPAGGDPAGLLPPEWEEDEERMSFLFSAFKRSREVNSTDWDSKMGFWAPLV
LSHSRRQGVVRLRLRDLQEAFQRKGSVPLGLATVLQDLLRRGELQRESDFMASVDSSWIS
WGVGVFLLKPLKWTLSNMLGDNKVPAEEVLVAVELLKEKAEEVYRLYQNSPLSSHPVVAL
SELSTLCANSCPDERTFYLVLLQLQKEKRVTVLEQNGEKIVKFARGPRAKVSPVNDVDVG
VYQLMQSEQLLSRKVESLSQEAERCKEEARRACRAGKKQLALRSLKAKQRTEKRIEALHA
KLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDE
VSQTLAGGVTNGLDFDSEELEKELDILLQDTTKEPLDLPDNPRNRHFTNSVPNPRISDAE
LEAELEKLSLSEGGLVPSSKSPKRQLEPTLKPL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccccggagcgggaggccgaggccccagccgggggagacccggcgggccttctg
ccccccgagtgggaggaggacgaggagcgcatgtccttcctgttctccgctttcaagagg
agtcgcgaggtgaacagcaccgactgggacagcaagatgggcttctgggcgccgttggtg
ctgagccacagccgccgccagggggtggtgcgcctgcgtctgcgggacttgcaggaggcc
tttcagcgcaaggggagcgtcccgctggggctggccacggtgctgcaggacctgctgcgt
cgaggggagctgcagcgggagtcagacttcatggccagtgtagacagcagctggatctcc
tggggggttggggtcttcctgctgaagcctctcaagtggactctttctaacatgctggga
gataataaggttccagctgaggaggtccttgtcgctgtggagctgttgaaggaaaaggct
gaggaggtgtatcgtctgtatcagaactcgcccctctcctcccaccccgtggtggccctg
tcagagctcagcaccctctgtgctaactcctgcccagatgagaggaccttctacttggtg
ttgctgcagctgcagaaggagaagagggtcacagtcctcgagcagaacggggagaagatt
gtgaagtttgcccgagggccacgtgccaaggtctctccagtcaatgacgtagatgttggg
gtgtaccagctgatgcagagtgaacagcttctctcacgcaaagtggagtccttatcccag
gaagcagagaggtgtaaagaagaagcccgccgggcatgccgagcaggaaagaagcagctg
gcactgaggtctctcaaggccaagcaacggacagagaagcgcatcgaggccttgcatgcc
aagctggacactgttcaaggcatcctggaccggatctatgcctcccagacagatcagatg
gtttttaacgcctaccaggctggggtaggagcactcaaactctccatgaaggatgtcaca
gtggagaaggcagagagcctcgtggatcagatccaagagctctgtgacacccaggatgaa
gtttctcagactctggctggtggggtaacaaatggcttagattttgacagtgaagaactg
gagaaggaattggacatcctccttcaggataccaccaaagaacctttggatctgcctgac
aacccccgcaataggcattttaccaacagcgtgcctaaccctaggatctcagatgctgaa
cttgaagctgaacttgagaaactgtccttatcagagggaggtttggtcccaagcagtaaa
tctccaaaaaggcaattggaaccgactctaaagccattgtag

KEGG   Homo sapiens (human): 92421Help
Entry
92421             CDS       T01001                                 

Gene name
CHMP4C, SNF7-3, Shax3, VPS32C
Definition
(RefSeq) charged multivesicular body protein 4C
  KO
K12194  charged multivesicular body protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    92421 (CHMP4C)
  09143 Cell growth and death
   04217 Necroptosis
    92421 (CHMP4C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    92421 (CHMP4C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    92421 (CHMP4C)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    92421 (CHMP4C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   92421 (CHMP4C)
  Exosomal proteins of other body fluids (saliva and urine)
   92421 (CHMP4C)
  Exosomal proteins of colorectal cancer cells
   92421 (CHMP4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 DUF155 SYF2
Motif
Other DBs
NCBI-GeneID: 92421
NCBI-ProteinID: NP_689497
OMIM: 610899
HGNC: 30599
Ensembl: ENSG00000164695
Vega: OTTHUMG00000164726
Pharos: Q96CF2(Tbio)
UniProt: Q96CF2
Position
8q21.13
AA seq 233 aa AA seqDB search
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQ
NKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVH
ENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKM
TNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttgggcaagttctttaaagggggcggctcttctaagagccgagccgctccc
agtccccaggaggccctggtccgacttcgggagactgaggagatgctgggcaagaaacaa
gagtacctggaaaatcgaatccagagagaaatcgccctggccaagaagcacggcacgcag
aataagcgagctgcattacaggcactaaagagaaagaagaggttcgagaaacagctcact
cagattgatggcacactttctaccattgagttccagagagaagccctggagaactcacac
accaacactgaggtgttgaggaacatgggctttgcagcaaaagcgatgaaatctgttcat
gaaaacatggatctgaacaaaatagatgatttgatgcaagagatcacagagcaacaggat
atcgcccaagaaatctcagaagcattttctcaacgggttggctttggtgatgactttgat
gaggatgagttgatggcagaacttgaagaattggaacaggaggaattaaataagaagatg
acaaatatccgccttccaaatgtgccttcctcttctctcccagcacagccaaatagaaaa
ccaggcatgtcgtccactgcacgtcgatcccgagcagcatcttcccagagggcagaagaa
gaggatgatgatatcaaacaattggcagcttgggctacctaa

KEGG   Homo sapiens (human): 9525Help
Entry
9525              CDS       T01001                                 

Gene name
VPS4B, MIG1, SKD1, SKD1B, VPS4-2
Definition
(RefSeq) vacuolar protein sorting 4 homolog B
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9525 (VPS4B)
  09143 Cell growth and death
   04217 Necroptosis
    9525 (VPS4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9525 (VPS4B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    9525 (VPS4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 TIP49 AAA_22 IstB_IS21 AAA_16 RuvB_N AAA_14 AAA_5 AAA_2 AAA_18 DUF815 AAA_33 RNA_helicase AAA_24 PhoH AAA_7 AAA_17 Mg_chelatase NACHT Sigma54_activat TPR_1 MCM TPR_2
Motif
Other DBs
NCBI-GeneID: 9525
NCBI-ProteinID: NP_004860
OMIM: 609983
HGNC: 10895
Ensembl: ENSG00000119541
Vega: OTTHUMG00000132790
Pharos: O75351(Tbio)
UniProt: O75351 A0A024R2C5
Structure
PDB: 

Position
18q21.33
AA seq 444 aa AA seqDB search
MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRA
KCTEYLDRAEKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQL
QGAIVIERPNVKWSDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGK
SYLAKAVATEANNSTFFSISSSDLVSKWLGESEKLVKNLFQLARENKPSIIFIDEIDSLC
GSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNIPWVLDSAIRRRFEKRIYIPL
PEPHARAAMFKLHLGTTQNSLTEADFRELGRKTDGYSGADISIIVRDALMQPVRKVQSAT
HFKKVRGPSRADPNHLVDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVSMSDMLRSLSN
TKPTVNEHDLLKLKKFTEDFGQEG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccacttcgcccaacctccagaaagcgatagatctggctagcaaagcagcgcaa
gaagacaaggctgggaactacgaagaagcccttcagctctatcagcatgctgtgcagtat
tttcttcatgtcgttaaatatgaagcacagggtgataaagccaagcaaagtatcagggca
aagtgtacagaatatcttgatagagcagaaaaactaaaggagtacctgaaaaataaagag
aaaaaagcacagaagccagtgaaagaaggacagccgagtccagcagatgagaaggggaat
gacagtgatggggaaggagaatctgatgatcctgaaaaaaagaaactacagaatcaactt
caaggtgccattgttatagaacgaccaaatgtgaaatggagtgacgttgctggacttgaa
ggagccaaagaagcactgaaagaggctgtgatactgcctattaaatttcctcatcttttt
acaggcaagagaacaccttggaggggaatcctattatttgggccgcctggaacaggaaag
tcctacttagccaaagctgtagcaacagaagccaacaactcaacatttttttcaatatct
tcctctgatcttgtttctaagtggctaggtgaaagtgaaaaactggttaagaatttattc
caacttgccagagagaacaagccctccattatcttcattgatgaaattgattctctctgt
ggttcaagaagtgaaaatgaaagtgaagccgcacgtagaattaagacggagttcctagtg
caaatgcaaggggttggtgtagacaatgatggaattttggttctgggagctacaaatata
ccctgggttctggattctgccattaggcgaagatttgagaaacgaatttatattcccttg
ccggaaccccatgcccgagcagcaatgtttaaactgcacctagggaccactcagaacagt
ctcacggaagcagactttcgggaacttgggaggaaaacagatggttattcaggggcagat
ataagtatcattgtacgtgatgcccttatgcagcctgttaggaaagtacagtcagctact
cattttaaaaaggttcgcggaccttcccgagctgatcctaaccatcttgtagatgatctg
ctaacaccttgctctccaggtgaccctggtgccattgaaatgacatggatggatgtccct
ggagataaacttttggagccagttgtttccatgtcggatatgttgcggtcactatctaac
acaaaacctacagtcaatgaacatgacttgttgaaattaaagaagtttacagaagatttt
ggtcaagaaggctaa

DBGET integrated database retrieval system