KEGG   Homo sapiens (human): 100526842
Entry
100526842         CDS       T01001                                 

Gene name
RPL17-C18orf32, PD-1, RPL17
Definition
(RefSeq) RPL17-C18orf32 readthrough
  KO
K02880  large subunit ribosomal protein L17e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100526842 (RPL17-C18orf32)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    100526842 (RPL17-C18orf32)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    100526842 (RPL17-C18orf32)
SSDB
Motif
Pfam: Ribosomal_L22
Other DBs
NCBI-GeneID: 100526842
NCBI-ProteinID: NP_001186284
HGNC: 44661
Ensembl: ENSG00000215472
Vega: OTTHUMG00000179689
UniProt: A0A0A6YYL6
Position
18q21.1
AA seq 228 aa
MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPF
RRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVN
KAPKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKLRSSSLGKWCA
FLVSSFQFCSGSTKNSWSHIYTLWFPPSLVVYGLRKQYKNPMIQTKAK
NT seq 687 nt   +upstreamnt  +downstreamnt
atggttcgctattcacttgacccggagaaccccacgaaatcatgcaaatcaagaggttcc
aatcttcgtgttcactttaagaacactcgtgaaactgctcaggccatcaagggtatgcat
atacgaaaagccacgaagtatctgaaagatgtcactttacagaaacagtgtgtaccattc
cgacgttacaatggtggagttggcaggtgtgcgcaggccaagcaatggggctggacacaa
ggtcggtggcccaaaaagagtgctgaatttttgctgcacatgcttaaaaacgcagagagt
aatgctgaacttaagggtttagatgtagattctctggtcattgagcatatccaagtgaac
aaagcacctaagatgcgccgccggacctacagagctcatggtcggattaacccatacatg
agctctccctgccacattgagatgatccttacggaaaaggaacagattgttcctaaacca
gaagaggaggttgcccagaagaaaaagttgaggagctcaagcttgggaaaatggtgtgca
ttccttgtatcgtcattccagttctgctctggatctacaaaaaattcctggagccatata
tataccctctggtttcccccttcgttagtcgtatatggcctaagaaagcaatacaagaat
ccaatgatacaaacaaaggcaaagtaa

DBGET integrated database retrieval system