KEGG   Homo sapiens (human): 100529097
Entry
100529097         CDS       T01001                                 

Gene name
RPL36A-HNRNPH2
Definition
(RefSeq) RPL36A-HNRNPH2 readthrough
  KO
K02929  large subunit ribosomal protein L44e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100529097 (RPL36A-HNRNPH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    100529097 (RPL36A-HNRNPH2)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    100529097 (RPL36A-HNRNPH2)
  Archaea
    100529097 (RPL36A-HNRNPH2)
SSDB
Motif
Pfam: Ribosomal_L44 NOB1_Zn_bind SVWC
Other DBs
NCBI-GeneID: 100529097
NCBI-ProteinID: NP_001186902
HGNC: 48349
Ensembl: ENSG00000257529
Position
Xq22.1
AA seq 118 aa
MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKA
KTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKLHQNCIEPNLPPRAQQSP
NT seq 357 nt   +upstreamnt  +downstreamnt
atggttaacgtccctaaaacccgccggactttctgtaagaagtgtggcaagcaccaaccc
cataaagtgacacagtacaagaagggcaaggattctctgtacgcccagggaaagcggcgt
tatgacaggaagcagagtggctatggtgggcaaactaagccgattttccggaaaaaggct
aaaactacaaagaagattgtgctaaggcttgagtgcgttgagcccaactgcagatctaag
agaatgctggctattaaaagatgcaagcattttgaactgggaggagataagaagagaaag
ctacaccaaaattgcattgagccaaacttgccaccaagagcccaacaatcaccatga

DBGET integrated database retrieval system