KEGG   Homo sapiens (human): 100529215Help
Entry
100529215         CDS       T01001                                 

Gene name
ZNF559-ZNF177
Definition
(RefSeq) ZNF559-ZNF177 readthrough
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100529215 (ZNF559-ZNF177)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100529215 (ZNF559-ZNF177)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    100529215 (ZNF559-ZNF177)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 XPA_N C1_1 Zn-ribbon_8 zf-LYAR zinc_ribbon_15 zf-met C1_4 DUF3268 Zn_ribbon_SprT
Motif
Other DBs
NCBI-GeneID: 100529215
NCBI-ProteinID: NP_001166121
HGNC: 42964
Ensembl: ENSG00000270011
Vega: OTTHUMG00000183958
UniProt: Q13360
Position
19p13.2
AA seq 321 aa AA seqDB search
MAAGWLTTWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNLASVGYQLCRH
SLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTNCVRTHSG
EMPYECSDCGKAFIFQSSLKKHMRSHTGEKPYECDHCGKSFSQSSHLNVHKRTHTGEKPY
DCKECGKAFTVPSSLQKHVRTHTGEKPYECSDCGKAFIDQSSLKKHTRSHTGEKPYECNQ
CGKSFSTGSYLIVHKRTHTGEKTYECKECGKAFRNSSCLRVHVRTHTGEKPYKCIQCEKA
FSTSTNLIMHKRIHNGQKLHE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagggtggctgacaacctggtcacagaactcagtaaccttccaggaagtggca
gtggacttttcccaggaggagtgggcattgctggaccctgctcaaaaaaatctatacaaa
gatgtgatgctggagaactttaggaacctggcctcagtagggtatcagctctgcagacac
agtctgatctccaaggtggatcaagaacagctgaagacagatgaaagaggaattttacaa
ggtgactgtgcagactgggaaactcaacttaaaccaaaagatacaattgctatgcagaac
attcctgggggaaaaacatccaatggcataaacacgaactgtgtcagaactcactctgga
gagatgccctatgaatgcagtgactgtgggaaagccttcatttttcagtcttcccttaag
aaacacatgagatctcatactggagagaagccttatgagtgtgatcactgtggaaaatcc
tttagccagagctctcatctgaatgtgcacaaaagaactcacactggagagaaaccctat
gactgtaaggaatgtgggaaggctttcactgttccttcatcccttcagaaacatgtgaga
acccacactggagagaaaccctatgaatgcagtgactgtggaaaagccttcatcgatcag
tcatcccttaagaaacacacacgctctcacactggagagaagccttatgagtgtaaccag
tgtggaaagtccttcagcacaggctcttaccttattgtgcacaagagaactcacactggt
gagaaaacctatgagtgtaaagaatgtgggaaggcctttaggaattcctcttgcctgagg
gtacacgtgagaactcacactggagagaagccttataaatgtattcagtgtgaaaaagcc
tttagcacaagcactaaccttataatgcacaagcgaatccacaatggccagaaactccat
gaatga

DBGET integrated database retrieval system