KEGG   Homo sapiens (human): 100529261
Entry
100529261         CDS       T01001                                 

Symbol
CHURC1-FNTB, FNTB, FTase-beta
Name
(RefSeq) CHURC1-FNTB readthrough
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_C SQHop_cyclase_N
Other DBs
NCBI-GeneID: 100529261
NCBI-ProteinID: NP_001189487
HGNC: 42960
Ensembl: ENSG00000125954
Vega: OTTHUMG00000170219
UniProt: P49356
Position
14q23.3
AA seq 391 aa
MIAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYW
ILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTE
EAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTA
EWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEG
GFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCP
AGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPD
KVIQATTYFLQKPVPGFEELKDETSAEPATD
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgatcgcaaaagtagaagaaaagatccaagaggtcttcagttcttacaagttcaaccac
cttgtaccaaggcttgttttgcagagggagaagcacttccattatctgaaaagaggcctt
cgacaactgacagatgcctatgagtgtctggatgccagccgcccatggctctgctattgg
atcctgcacagcttggaactgctagatgaacccatcccccagatagtggctacagatgtg
tgtcagttcctggagctgtgtcagagcccagaaggtggctttggaggaggacccggtcag
tatccacaccttgcacccacatatgcagcagtcaatgcattgtgcatcattggcaccgag
gaggcctatgacatcattaacagagagaagcttcttcagtatttgtactccctgaagcaa
cctgacggctcctttctcatgcatgtcggaggtgaggtggatgtgagaagcgcatactgt
gctgcctccgtagcctcgctgaccaacatcatcactccagacctctttgagggcactgct
gaatggatagcaaggtgtcagaactgggaaggtggcattggcggggtaccagggatggaa
gcccatggtggctataccttctgtggcctggccgcgctggtaatcctcaagagggaacgt
tccttgaacttgaagagcttattacaatgggtgacaagccggcagatgcgatttgaagga
ggatttcagggccgctgcaacaagctggtggatggctgctactccttctggcaggcgggg
ctcctgcccctgctccaccgcgcactgcacgcccaaggtgaccctgcccttagcatgagc
cactggatgttccatcagcaggccctgcaggagtacatcctgatgtgctgccagtgccct
gcgggggggcttctggataaacctggcaagtcgcgtgatttctaccacacctgctactgc
ctgagcggcctgtccatagcccagcacttcggcagcggagccatgttgcatgatgtggtc
ctgggtgtgcccgaaaacgctctgcagcccactcacccagtgtacaacattggaccagac
aaggtgatccaggccactacatactttctacagaagccagtcccaggttttgaggagctt
aaggatgagacatcggcagagcctgcaaccgactag

DBGET integrated database retrieval system