KEGG   Homo sapiens (human): 10053Help
Entry
10053             CDS       T01001                                 

Gene name
AP1M2, AP1-mu2, HSMU1B, MU-1B, MU1B, mu2
Definition
(RefSeq) adaptor related protein complex 1 subunit mu 2
  KO
K12393  AP-1 complex subunit mu
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    10053 (AP1M2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    10053 (AP1M2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10053 (AP1M2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    10053 (AP1M2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adap_comp_sub Clat_adaptor_s Dymeclin
Motif
Other DBs
NCBI-GeneID: 10053
NCBI-ProteinID: NP_005489
OMIM: 607309
HGNC: 558
Ensembl: ENSG00000129354
Vega: OTTHUMG00000180584
Pharos: Q9Y6Q5(Tbio)
UniProt: Q9Y6Q5
Position
19p13.2
AA seq 423 aa AA seqDB search
MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWI
KHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDF
GFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVN
LLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQ
CVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQ
FKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHF
GLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQL
RTS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctcggctgtcttcattctggacgttaagggcaagccattgatcagccgcaac
tacaagggcgatgtggccatgagcaagattgagcacttcatgcctttgctggtacagcgg
gaggaggaaggcgccctggccccgctgctgagccacggccaggtccacttcctatggatc
aaacacagcaacctctacttggtggccaccacatcgaagaatgccaatgcctccctggtg
tactccttcctgtataagacaatagaggtattctgcgaatacttcaaggagctggaggag
gagagcatccgggacaactttgtcatcgtctacgagttgctggacgagctcatggacttt
ggcttcccgcagaccaccgacagcaagatcctgcaggagtacatcactcagcagagcaac
aagctggagacgggcaagtcacgggtgccacccactgtcaccaacgctgtgtcctggcgc
tccgagggtatcaagtataagaagaacgaggtcttcattgatgtcatagagtctgtcaac
ctgctggtcaatgccaacggcagcgtccttctgagcgaaatcgtcggtaccatcaagctc
aaggtgtttctgtcaggaatgccagagctgcggctgggcctcaatgaccgcgtgctcttc
gagctcactggccgcagcaagaacaaatcagtagagctggaggatgtaaaattccaccag
tgcgtgcggctctctcgctttgacaacgaccgcaccatctccttcatcccgcctgatggt
gactttgagctcatgtcataccgcctcagcacccaggtcaagccactgatctggattgag
tctgtcattgagaagttctcccacagccgcgtggagatcatggtcaaggccaaggggcag
tttaagaaacagtcagtggccaacggtgtggagatatctgtgcctgtacccagcgatgcc
gactcccccagattcaagaccagtgtgggcagcgccaagtatgtgccggagagaaacgtc
gtgatttggagtattaagtctttcccggggggcaaggagtacttgatgcgagcccacttt
ggcctccccagtgtggaaaaggaagaggtggagggccggccccccatcggggtcaagttt
gagatcccctacttcaccgtctctgggatccaggtccgatacatgaagatcattgagaaa
agtggttaccaggccctgccctgggttcgctacatcacccagagtggcgattaccaactt
cgtaccagctag

DBGET integrated database retrieval system