KEGG   Homo sapiens (human): 100532726Help
Entry
100532726         CDS       T01001                                 

Gene name
NDUFC2-KCTD14
Definition
(RefSeq) NDUFC2-KCTD14 readthrough
  KO
K03968  NADH dehydrogenase (ubiquinone) 1 subunit C2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100532726 (NDUFC2-KCTD14)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100532726 (NDUFC2-KCTD14)
  09159 Environmental adaptation
   04714 Thermogenesis
    100532726 (NDUFC2-KCTD14)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    100532726 (NDUFC2-KCTD14)
   05012 Parkinson disease
    100532726 (NDUFC2-KCTD14)
   05016 Huntington disease
    100532726 (NDUFC2-KCTD14)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100532726 (NDUFC2-KCTD14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_C2
Motif
Other DBs
NCBI-GeneID: 100532726
NCBI-ProteinID: NP_001190190
HGNC: 42956
Ensembl: ENSG00000259112
Vega: OTTHUMG00000171802
Pharos: E9PQ53(Tdark)
UniProt: E9PQ53
Position
11q14.1
AA seq 114 aa AA seqDB search
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ
LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDVYCCGAERRG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcacggcggaacccagaacccttacggtttctgccggatgaggcccggagcctg
cccccgcccaagctgaccgacccgcggctcctctacatcggcttcttgggctactgctcc
ggcctgattgataacctaatccggcggaggccgatcgcgacggctggtttgcatcgccag
cttctatatattacggcctttttttttgctggatattatcttgtaaaacgtgaagactac
ctgtatgctgtgagggaccgtgaaatgtttggatatatgaaattacatccagaggatttt
cctgaagaagatgtctactgttgtggagctgaacgtcgggggtga

KEGG   Homo sapiens (human): 126328Help
Entry
126328            CDS       T01001                                 

Gene name
NDUFA11, B14.7, CI-B14.7
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A11
  KO
K03956  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    126328 (NDUFA11)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    126328 (NDUFA11)
  09159 Environmental adaptation
   04714 Thermogenesis
    126328 (NDUFA11)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    126328 (NDUFA11)
   05012 Parkinson disease
    126328 (NDUFA11)
   05016 Huntington disease
    126328 (NDUFA11)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    126328 (NDUFA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tim17
Motif
Other DBs
NCBI-GeneID: 126328
NCBI-ProteinID: NP_783313
OMIM: 612638
HGNC: 20371
Ensembl: ENSG00000174886
Vega: OTTHUMG00000180617
Pharos: Q86Y39(Tclin)
UniProt: Q86Y39
Structure
PDB: 

Position
19p13.3
AA seq 141 aa AA seqDB search
MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYT
FTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGI
AASLVKMGRLEGWEVFAKPKV
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaaggtttttcgtcagtactgggatatccccgatggcaccgattgccaccgc
aaagcctacagcaccaccagtattgccagcgtcgctggcctgaccgccgctgcctacaga
gtcacactcaatcctccgggcaccttccttgaaggagtggctaaggttggacaatacacg
ttcactgcagctgctgtcggggccgtgtttggcctcaccacctgcatcagcgcccatgtc
cgcgagaagcccgacgaccccctgaactacttcctcggtggctgcgccggaggcctgact
ctgggagcacgcacgcacaactacgggattggcgccgccgcctgcgtgtactttggcata
gcggcctccctggtcaagatgggccggctggagggctgggaggtgtttgcaaaacccaag
gtgtga

KEGG   Homo sapiens (human): 374291Help
Entry
374291            CDS       T01001                                 

Gene name
NDUFS7, CI-20, CI-20KD, MY017, PSST
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S7
  KO
K03940  NADH dehydrogenase (ubiquinone) Fe-S protein 7 [EC:1.6.5.3 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    374291 (NDUFS7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    374291 (NDUFS7)
  09159 Environmental adaptation
   04714 Thermogenesis
    374291 (NDUFS7)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    374291 (NDUFS7)
   05012 Parkinson disease
    374291 (NDUFS7)
   05016 Huntington disease
    374291 (NDUFS7)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    374291 (NDUFS7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     374291 (NDUFS7)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     374291 (NDUFS7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxidored_q6
Motif
Other DBs
NCBI-GeneID: 374291
NCBI-ProteinID: NP_077718
OMIM: 601825
HGNC: 7714
Ensembl: ENSG00000115286
Vega: OTTHUMG00000168077
Pharos: O75251(Tclin)
UniProt: O75251 Q7LD69
Structure
PDB: 

Position
19p13.3
AA seq 213 aa AA seqDB search
MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRG
EYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVM
IVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYI
PGCPPTAEALLYGILQLQRKIKRERRLQIWYRR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgctgtcagctcctggcctgcgcggcttccggatccttggtctgcgctccagc
gtgggcccggctgtgcaggcacgaggtgtccatcagagcgtggccaccgatggcccaagc
agcacccagcctgccctgccaaaggccagagccgtggctcccaaacccagcagccggggc
gagtatgtggtggccaagctggatgacctcgtcaactgggcccgccggagttctctgtgg
cccatgaccttcggcctggcctgctgcgccgtggagatgatgcacatggcagcaccccgc
tacgacatggaccgctttggcgtggtcttccgcgccagcccgcgccagtccgacgtcatg
atcgtggccggcacactcaccaacaagatggccccagcgcttcgcaaggtctacgaccag
atgccggagccgcgctacgtggtctccatggggagctgcgccaacggaggaggctactac
cactattcctactcggtggtgaggggctgcgaccgcatcgtgcccgtggacatctacatc
ccaggctgcccacctacggccgaggccctgctctacggcatcctgcagctgcagaggaag
atcaagcgggagcggaggctgcagatctggtaccgcaggtag

KEGG   Homo sapiens (human): 4694Help
Entry
4694              CDS       T01001                                 

Gene name
NDUFA1, CI-MWFE, MWFE, ZNF183
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4694 (NDUFA1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4694 (NDUFA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4694 (NDUFA1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4694 (NDUFA1)
   05012 Parkinson disease
    4694 (NDUFA1)
   05016 Huntington disease
    4694 (NDUFA1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4694 (NDUFA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MWFE
Motif
Other DBs
NCBI-GeneID: 4694
NCBI-ProteinID: NP_004532
OMIM: 300078
HGNC: 7683
Ensembl: ENSG00000125356
Vega: OTTHUMG00000022287
Pharos: O15239(Tclin)
UniProt: O15239 Q6IBB5
Structure
PDB: 

Position
Xq24
AA seq 70 aa AA seqDB search
MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRY
YVSKGLENID
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcgagattctccccggactctccgtcatgggcgtgtgcttgttgattccagga
ctggctactgcgtacatccacaggttcactaacgggggcaaggaaaaaagggttgctcat
tttgggtatcactggagtctgatggaaagagataggcgcatctctggagttgatcgttac
tatgtgtcaaagggtttggagaacattgattaa

KEGG   Homo sapiens (human): 4695Help
Entry
4695              CDS       T01001                                 

Gene name
NDUFA2, B8, CD14, CIB8
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A2
  KO
K03946  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4695 (NDUFA2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4695 (NDUFA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4695 (NDUFA2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4695 (NDUFA2)
   05012 Parkinson disease
    4695 (NDUFA2)
   05016 Huntington disease
    4695 (NDUFA2)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4695 (NDUFA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 4695
NCBI-ProteinID: NP_002479
OMIM: 602137
HGNC: 7685
Ensembl: ENSG00000131495
Vega: OTTHUMG00000129505
Pharos: O43678(Tclin)
UniProt: O43678
Structure
PDB: 

Position
5q31.3
AA seq 99 aa AA seqDB search
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSD
VQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgcagcaagtcgaggagtcggggcaaagctgggcctgcgtgagattcgc
atccacttatgtcagcgctcgcccggcagccagggcgtcagggacttcattgagaaacgc
tacgtggagctgaagaaggcgaatcccgacctacccatcctaatccgcgaatgctccgat
gtgcagcccaagctctgggcccgctacgcatttggccaagagacgaatgtccctttgaac
aacttcagtgctgatcaggtaaccagagccctggagaacgttctaagtggtaaagcctga

KEGG   Homo sapiens (human): 4696Help
Entry
4696              CDS       T01001                                 

Gene name
NDUFA3, B9, CI-B9
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A3
  KO
K03947  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4696 (NDUFA3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4696 (NDUFA3)
  09159 Environmental adaptation
   04714 Thermogenesis
    4696 (NDUFA3)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4696 (NDUFA3)
   05012 Parkinson disease
    4696 (NDUFA3)
   05016 Huntington disease
    4696 (NDUFA3)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4696 (NDUFA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADHdh_A3
Motif
Other DBs
NCBI-GeneID: 4696
NCBI-ProteinID: NP_004533
OMIM: 603832
HGNC: 7686
Ensembl: ENSG00000170906
Vega: OTTHUMG00000064972
Pharos: O95167(Tclin)
UniProt: O95167 Q6FGG4
Structure
PDB: 

Position
19q13.42
AA seq 84 aa AA seqDB search
MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDD
GNMPDVPSHPQDPQGPSLEWLKKL
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagagtcggcgccttcctcaagaatgcctgggacaaggagccagtgctggtc
gtgtccttcgtcgtcgggggcctcgctgtaattctgcccccattgagcccctacttcaag
tactccgtcatgatcaacaaggccacgccctacaactacccagtgcccgtccgtgatgat
gggaacatgcccgacgtgcccagccacccccaggaccctcagggccccagcctggagtgg
ctgaagaaactgtga

KEGG   Homo sapiens (human): 4697Help
Entry
4697              CDS       T01001                                 

Gene name
NDUFA4, CI-9k, CI-MLRQ, MLRQ
Definition
(RefSeq) NDUFA4, mitochondrial complex associated
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4697 (NDUFA4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4697 (NDUFA4)
  09159 Environmental adaptation
   04714 Thermogenesis
    4697 (NDUFA4)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4697 (NDUFA4)
   05012 Parkinson disease
    4697 (NDUFA4)
   05016 Huntington disease
    4697 (NDUFA4)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4697 (NDUFA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B12D
Motif
Other DBs
NCBI-GeneID: 4697
NCBI-ProteinID: NP_002480
OMIM: 603833
HGNC: 7687
Ensembl: ENSG00000189043
Vega: OTTHUMG00000023880
Pharos: O00483(Tclin)
UniProt: O00483 A0A024R9Z0
Position
7p21.3
AA seq 81 aa AA seqDB search
MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPND
QYKFYSVNVDYSKLKKERPDF
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgctccgccagatcatcggtcaggccaagaagcatccgagcttgatccccctctttgta
tttattggaactggagctactggagcaacactgtatctcttgcgtctggcattgttcaat
ccagatgtttgttgggacagaaataacccagagccctggaacaaactgggtcccaatgat
caatacaagttctactcagtgaatgtggattacagcaagctgaagaaggaacgtccagat
ttctaa

KEGG   Homo sapiens (human): 4698Help
Entry
4698              CDS       T01001                                 

Gene name
NDUFA5, B13, CI-13KD-B, CI-13kB, NUFM, UQOR13
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A5
  KO
K03949  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4698 (NDUFA5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4698 (NDUFA5)
  09159 Environmental adaptation
   04714 Thermogenesis
    4698 (NDUFA5)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4698 (NDUFA5)
   05012 Parkinson disease
    4698 (NDUFA5)
   05016 Huntington disease
    4698 (NDUFA5)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4698 (NDUFA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETC_C1_NDUFA5 Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 4698
NCBI-ProteinID: NP_001269349
OMIM: 601677
HGNC: 7688
Ensembl: ENSG00000128609
Vega: OTTHUMG00000157348
Pharos: Q16718(Tclin)
UniProt: Q16718
Structure
PDB: 

Position
7q31.32
AA seq 116 aa AA seqDB search
MPYRVGQTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVK
AEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgccttaccgggtagggcagaccactggccttgtgggattggctgtgtgcaatactcct
cacgagaggctaagaatattgtacacaaagattcttgatgttcttgaggaaatccctaaa
aatgcagcatatagaaagtatacagaacagattacaaatgagaagctggctatggttaaa
gcggaaccagatgttaaaaaattagaagaccaacttcaaggcggtcaattagaagaggtg
attcttcaggctgaacatgaactaaatctggcaagaaaaatgagggaatggaaactatgg
gagccattagtggaagagcctcctgccgatcagtggaaatggccaatataa

KEGG   Homo sapiens (human): 4700Help
Entry
4700              CDS       T01001                                 

Gene name
NDUFA6, B14, CI-B14, LYRM6, NADHB14
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A6
  KO
K03950  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4700 (NDUFA6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4700 (NDUFA6)
  09159 Environmental adaptation
   04714 Thermogenesis
    4700 (NDUFA6)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4700 (NDUFA6)
   05012 Parkinson disease
    4700 (NDUFA6)
   05016 Huntington disease
    4700 (NDUFA6)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4700 (NDUFA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_LYR Complex1_LYR_2 DUF4252
Motif
Other DBs
NCBI-GeneID: 4700
NCBI-ProteinID: NP_002481
OMIM: 602138
HGNC: 7690
Ensembl: ENSG00000184983
Vega: OTTHUMG00000151287
Pharos: P56556(Tclin)
UniProt: P56556
Structure
PDB: 

Position
22q13.2
AA seq 128 aa AA seqDB search
MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGR
DKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLS
KFYVGHDP
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcggggagcggcgtccgccaagctacttctaccgccagcaccttcgtgaagcccatt
ttcagtcgggacatgaacgaggccaagcggagggtgcgcgagctctaccgcgcctggtat
cgggaggtgccgaacactgtgcaccaattccagctggacatcactgtgaaaatgggacgg
gataaagtccgagaaatgtttatgaagaatgcccatgtcacagaccccagggtggttgat
cttctggtcattaagggaaagatcgaactggaagaaacaattaaagtatggaagcagcgg
acacatgttatgcggttcttccatgaaacagaagcgccaaggccaaaggatttcctatcc
aagttctatgttggccacgatccatga

KEGG   Homo sapiens (human): 4701Help
Entry
4701              CDS       T01001                                 

Gene name
NDUFA7, B14.5a, CI-B14.5a
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A7
  KO
K03951  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4701 (NDUFA7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4701 (NDUFA7)
  09159 Environmental adaptation
   04714 Thermogenesis
    4701 (NDUFA7)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4701 (NDUFA7)
   05012 Parkinson disease
    4701 (NDUFA7)
   05016 Huntington disease
    4701 (NDUFA7)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4701 (NDUFA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CI-B14_5a
Motif
Other DBs
NCBI-GeneID: 4701
NCBI-ProteinID: NP_004992
OMIM: 602139
HGNC: 7691
Ensembl: ENSG00000267855
Vega: OTTHUMG00000182459
Pharos: O95182(Tclin)
UniProt: O95182
Structure
PDB: 

Position
19p13.2
AA seq 113 aa AA seqDB search
MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGR
RESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgccacccgtctcatccagcggctgcggaactgggcgtccgggcatgacctg
caggggaagctgcagctacgctaccaggagatctccaagcgaactcagcctcctcccaag
ctccctgtgggtcctagccacaagctctccaacaattactattgcactcgcgatggccgc
cgggaatctgtgcccccttccatcatcatgtcgtcgcagaaggcgctggtgtcaggcaag
ccagcagagagctctgctgtagctgccactgagaagaaggcggtgactccagctcctccc
ataaagaggtgggagctgtcctcggaccagccttacctgtga

KEGG   Homo sapiens (human): 4702Help
Entry
4702              CDS       T01001                                 

Gene name
NDUFA8, CI-19KD, CI-PGIV, PGIV
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A8
  KO
K03952  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4702 (NDUFA8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4702 (NDUFA8)
  09159 Environmental adaptation
   04714 Thermogenesis
    4702 (NDUFA8)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4702 (NDUFA8)
   05012 Parkinson disease
    4702 (NDUFA8)
   05016 Huntington disease
    4702 (NDUFA8)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4702 (NDUFA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHCH CX9C Cmc1
Motif
Other DBs
NCBI-GeneID: 4702
NCBI-ProteinID: NP_055037
OMIM: 603359
HGNC: 7692
Ensembl: ENSG00000119421
Vega: OTTHUMG00000020598
Pharos: P51970(Tclin)
UniProt: P51970
Structure
PDB: 

Position
9q33.2
AA seq 172 aa AA seqDB search
MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEG
KLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRP
DLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccggggatagtggagctgcccactctagaggagctgaaagtagatgaggtgaaaatt
agttctgctgtgcttaaagctgcggcccatcactatggagctcaatgtgataagcccaac
aaggagtttatgctctgccgctgggaagagaaagatccgaggcggtgtttagaggaaggc
aaactggtcaacaagtgtgctttggacttctttaggcagataaaacgtcactgtgcagag
ccttttacagaatattggacttgcattgattatactggccagcagttatttcgtcactgt
cgcaaacagcaggcaaagtttgacgagtgtgtgctggacaaactgggctgggtgcggcct
gacctgggagaactgtcaaaggtcaccaaagtgaaaacagatcgacctttaccggagaat
ccctatcactcaagaccaagaccggatcccagccctgagatcgagggagatctgcagcct
gccacacatggcagccgcttttatttctggaccaagtaa

KEGG   Homo sapiens (human): 4704Help
Entry
4704              CDS       T01001                                 

Gene name
NDUFA9, CC6, CI-39k, CI39k, NDUFS2L, SDR22E1
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A9
  KO
K03953  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4704 (NDUFA9)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4704 (NDUFA9)
  09159 Environmental adaptation
   04714 Thermogenesis
    4704 (NDUFA9)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4704 (NDUFA9)
   05012 Parkinson disease
    4704 (NDUFA9)
   05016 Huntington disease
    4704 (NDUFA9)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4704 (NDUFA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD NmrA NAD_binding_10 RmlD_sub_bind NAD_binding_4 GDP_Man_Dehyd adh_short
Motif
Other DBs
NCBI-GeneID: 4704
NCBI-ProteinID: NP_004993
OMIM: 603834
HGNC: 7693
Ensembl: ENSG00000139180
Vega: OTTHUMG00000168224
Pharos: Q16795(Tclin)
UniProt: Q16795
Structure
PDB: 

Position
12p13.32
AA seq 377 aa AA seqDB search
MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFG
ATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV
QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRY
LRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV
YVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRW
VARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYR
WLSAEIEDVKPAKTVNI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgccgcacaatcccgggttgtccgggtcctgtcaatgtcacgttctgccatt
actgcaatagccacatctgtgtgtcacggcccaccctgtcgccagcttcatcatgccctc
atgcctcatgggaaaggtggacgttcctcagtcagtgggattgtggccactgtgtttgga
gcaacaggattcctggggcgatatgttgtcaaccaccttggacgcatggggtcacaggta
atcataccctatcggtgtgataaatatgacatcatgcaccttcgtcccatgggtgacctg
ggccagcttctgtttctggaatgggacgcgagagataaagattctatccgacgagtagta
caacacagcaatgtggtcatcaatcttattggacgagactgggaaaccaaaaactttgat
tttgaggatgtttttgtgaagattccccaagcaattgctcaactgtccaaggaagctgga
gttgaaaaattcattcatgtttcacatctgaatgcgaatattaaaagctcttctagatat
ttgagaaataaggctgttggagagaaagtagtgagagatgcatttccggaagccattatc
gtaaagccgtcggacatctttggaagagaggatagattccttaattcttttgcaagtatg
catcggtttggtcctataccccttggttccttgggctggaagacagttaaacaaccagta
tatgtcgtagatgtatccaaaggaattgttaatgcagttaaggatcctgatgccaatggg
aaatcctttgctttcgttggtcccagtcggtacctccttttccacctggtgaagtacatc
tttgctgtggctcacagattgttcctcccattccccttgccgctttttgcctatcgatgg
gtagcaagagtctttgaaataagcccatttgagccctggataacaagggataaagtggag
cggatgcacatcacagacatgaaattgcctcacctgcctggcttagaagaccttggtatt
caggcaacaccactggaactcaaggccattgaggtgctgcggcgtcatcgcacttaccgc
tggctgtctgctgaaattgaggatgtgaagccggccaagaccgtcaacatttag

KEGG   Homo sapiens (human): 4705Help
Entry
4705              CDS       T01001                                 

Gene name
NDUFA10, CI-42KD, CI-42k
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A10
  KO
K03954  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4705 (NDUFA10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4705 (NDUFA10)
  09159 Environmental adaptation
   04714 Thermogenesis
    4705 (NDUFA10)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4705 (NDUFA10)
   05012 Parkinson disease
    4705 (NDUFA10)
   05016 Huntington disease
    4705 (NDUFA10)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4705 (NDUFA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK Thymidylate_kin Cytidylate_kin AAA_18
Motif
Other DBs
NCBI-GeneID: 4705
NCBI-ProteinID: NP_004535
OMIM: 603835
HGNC: 7684
Ensembl: ENSG00000130414
Vega: OTTHUMG00000133350
Pharos: O95299(Tclin)
UniProt: O95299 A0A024R4B3
Structure
PDB: 

Position
2q37.3
AA seq 355 aa AA seqDB search
MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVI
TVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDD
PRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIR
KQCVDHYNEVKSVTICDYLPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENA
YKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQDNRTLYHLRLLVQD
KFEVLNYTSIPIFLPEVTIGAHQTDRVLHQFRELPGRKYSPGYNTEVGDKWIWLK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcggctcctgaagctggcagcgacgtccgcgtccgcccgggtcgtggcggcg
ggcgcccagcgcgtgagaggaattcatagcagtgtgcagtgcaaactgcgctatggaatg
tggcatttcctacttggggataaagcaagcaaaagactgacagaacgcagcagagtgata
actgtagatggcaatatatgtactggaaaaggcaaacttgcaaaagaaatagcagagaaa
ctaggcttcaagcactttcctgaagcggggattcattatccagacagtaccacaggagat
gggaagcccctcgccaccgactataatggcaactgtagtttggagaaattttacgatgat
ccgagaagcaatgatggcaacagttaccgcctgcagtcctggttgtacagcagtcgcctg
ctgcagtactcagatgccttggagcacttgctgaccacaggacaaggtgttgtgttggag
cgctccatcttcagtgactttgtgttcctggaggcgatgtacaaccagggattcatccga
aagcagtgtgtggaccactacaacgaggtgaagagcgtcaccatctgcgattacctgccc
ccccacctggtgatttacatcgatgtgcccgttccagaggtccagaggcggattcagaag
aaaggagatccacatgaaatgaagatcacctctgcctatctacaggacattgagaatgcc
tataagaaaacctttctccctgagatgagtgaaaaatgtgaggttttacaatattctgca
agggaagctcaagattcaaaaaaggtggtagaggacattgaatacctgaagttcgataaa
gggccgtggctcaagcaggacaatcgcactttataccacctgcgattactggttcaggat
aagtttgaggtgctgaattacacaagcattcctatctttctcccggaagtcaccattgga
gctcatcagactgaccgtgtcttacatcagttcagagagctgccgggccgcaagtacagc
cctgggtacaacaccgaggtgggagacaagtggatctggctgaagtga

KEGG   Homo sapiens (human): 4706Help
Entry
4706              CDS       T01001                                 

Gene name
NDUFAB1, ACP, ACP1, FASN2A, SDAP
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit AB1
  KO
K03955  NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4706 (NDUFAB1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4706 (NDUFAB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4706 (NDUFAB1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4706 (NDUFAB1)
   05012 Parkinson disease
    4706 (NDUFAB1)
   05016 Huntington disease
    4706 (NDUFAB1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4706 (NDUFAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP-binding PP-binding_2 MinE
Motif
Other DBs
NCBI-GeneID: 4706
NCBI-ProteinID: NP_004994
OMIM: 603836
HGNC: 7694
Ensembl: ENSG00000004779
Vega: OTTHUMG00000096985
Pharos: O14561(Tclin)
UniProt: O14561
Structure
PDB: 

Position
16p12.2
AA seq 156 aa AA seqDB search
MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGR
VTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcgtgtcctttcagcctatgtcagccgcctgcccgcggcctttgcgccgctg
ccccgggtccggatgctggccgtggcccggcctctcagcaccgctctctgctccgcgggg
acccagacgaggctcgggactttgcagccggccttagtgctcgcgcaggttcctggtaga
gttacacagttgtgccgccagtatagcgacatgcctcctttgacgttagagggcatccag
gaccgtgttctttacgtattgaaactctatgacaagattgacccagagaagctttcagta
aattctcattttatgaaagacctgggcttagacagtttggaccaagtggagattatcatg
gccatggaagacgaatttgggtttgaaattcctgatatagatgctgaaaagttaatgtgt
ccacaagaaattgtagattacattgcagataagaaggatgtatatgaataa

KEGG   Homo sapiens (human): 4707Help
Entry
4707              CDS       T01001                                 

Gene name
NDUFB1, CI-MNLL, CI-SGDH, MNLL
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B1
  KO
K03957  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4707 (NDUFB1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4707 (NDUFB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4707 (NDUFB1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4707 (NDUFB1)
   05012 Parkinson disease
    4707 (NDUFB1)
   05016 Huntington disease
    4707 (NDUFB1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4707 (NDUFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADH_oxidored
Motif
Other DBs
NCBI-GeneID: 4707
NCBI-ProteinID: NP_004536
OMIM: 603837
HGNC: 7695
Ensembl: ENSG00000183648
Vega: OTTHUMG00000171180
Pharos: O75438(Tclin)
UniProt: O75438
Structure
PDB: 

Position
14q32.12
AA seq 105 aa AA seqDB search
MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWV
HVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgatttgctggcgtcacccctctgctccgtgcgggcgcggcgaatggcaggtcccgagg
tcgcagcttccactggcgcgggttgagttccctgttgcccttggtctcggggtcgctgta
ggcgctgaggctgcagctatcatggtgaacttacttcagattgtgcgggaccactgggtt
catgttcttgtccctatgggatttgtcattggatgttatttagacagaaagagtgatgaa
cggctaactgccttccggaacaagagtatgttatttaaaagggaattgcaacccagtgaa
gaagttacctggaagtaa

KEGG   Homo sapiens (human): 4708Help
Entry
4708              CDS       T01001                                 

Gene name
NDUFB2, AGGG, CI-AGGG
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B2
  KO
K03958  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4708 (NDUFB2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4708 (NDUFB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4708 (NDUFB2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4708 (NDUFB2)
   05012 Parkinson disease
    4708 (NDUFB2)
   05016 Huntington disease
    4708 (NDUFB2)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4708 (NDUFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADH_B2
Motif
Other DBs
NCBI-GeneID: 4708
NCBI-ProteinID: NP_004537
OMIM: 603838
HGNC: 7697
Ensembl: ENSG00000090266
Vega: OTTHUMG00000157424
Pharos: O95178(Tclin)
UniProt: O95178 A4D1T5
Structure
PDB: 

Position
7q34
AA seq 105 aa AA seqDB search
MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEF
FSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctctgactcggctggcgtctttcgctcgcgttggaggccgccttttcagaagc
ggctgcgcacggactgctggagatggtggagtccgtcatgccggtggtggtgtgcacatt
gagccccggtatagacagttcccccagctgaccagatcccaggtgttccagagcgagttc
ttcagcggactcatgtggttctggattctctggcgcttttggcatgactcagaagaggtg
ctgggtcactttccgtatcctgatccttcccagtggacagatgaagaattaggtatccct
cctgatgatgaagactga

KEGG   Homo sapiens (human): 4709Help
Entry
4709              CDS       T01001                                 

Gene name
NDUFB3, B12, CI-B12
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B3
  KO
K03959  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4709 (NDUFB3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4709 (NDUFB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    4709 (NDUFB3)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4709 (NDUFB3)
   05012 Parkinson disease
    4709 (NDUFB3)
   05016 Huntington disease
    4709 (NDUFB3)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4709 (NDUFB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B12
Motif
Other DBs
NCBI-GeneID: 4709
NCBI-ProteinID: NP_001244031
OMIM: 603839
HGNC: 7698
Ensembl: ENSG00000119013
Vega: OTTHUMG00000132820
Pharos: O43676(Tclin)
UniProt: O43676 A0A024R413
Structure
PDB: 

Position
2q33.1
AA seq 98 aa AA seqDB search
MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKS
VSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgaacatggacatgagcatggacatcataaaatggaacttccagattataga
caatggaagatagaagggacaccattagaaactatccagaagaagctggctgcaaaaggg
ctaagggatccatggggccgcaatgaagcttggagatacatgggtggctttgcaaagagt
gtttccttttctgatgtattctttaaaggattcaaatggggatttgctgcatttgtggta
gctgtaggagctgaatattacctggagtccctgaataaagataagaagcatcactga

KEGG   Homo sapiens (human): 4710Help
Entry
4710              CDS       T01001                                 

Gene name
NDUFB4, B15, CI-B15
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B4
  KO
K03960  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4710 (NDUFB4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4710 (NDUFB4)
  09159 Environmental adaptation
   04714 Thermogenesis
    4710 (NDUFB4)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4710 (NDUFB4)
   05012 Parkinson disease
    4710 (NDUFB4)
   05016 Huntington disease
    4710 (NDUFB4)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4710 (NDUFB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B4
Motif
Other DBs
NCBI-GeneID: 4710
NCBI-ProteinID: NP_004538
OMIM: 603840
HGNC: 7699
Ensembl: ENSG00000065518
Vega: OTTHUMG00000159442
Pharos: O95168(Tclin)
UniProt: O95168
Structure
PDB: 

Position
3q13.33
AA seq 129 aa AA seqDB search
MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLI
ENPALLRWAYARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK
LDRTFHLSY
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcccaaagtataagccgtcgagcctgcgcactctgcctgagaccctcgaccca
gccgaatacaacatatctccggaaacccggcgggcgcaagccgagcggttggccataaga
gcccagctgaaacgagagtacctgcttcagtacaacgatcccaaccgccgagggctcatc
gaaaatcctgccttgcttcgttgggcctatgcaagaacaataaatgtctatcctaatttc
agacccactcctaaaaactcactcatgggagctctgtgtggatttgggcccctcatcttc
atttattatattatcaaaactgagagggataggaaagaaaaacttatccaggaaggaaaa
ttggatcgaacatttcacctctcatattaa

KEGG   Homo sapiens (human): 4711Help
Entry
4711              CDS       T01001                                 

Gene name
NDUFB5, CISGDH, SGDH
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B5
  KO
K03961  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4711 (NDUFB5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4711 (NDUFB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    4711 (NDUFB5)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4711 (NDUFB5)
   05012 Parkinson disease
    4711 (NDUFB5)
   05016 Huntington disease
    4711 (NDUFB5)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4711 (NDUFB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B5 DUF3749
Motif
Other DBs
NCBI-GeneID: 4711
NCBI-ProteinID: NP_002483
OMIM: 603841
HGNC: 7700
Ensembl: ENSG00000136521
Vega: OTTHUMG00000157480
Pharos: O43674(Tclin)
UniProt: O43674
Structure
PDB: 

Position
3q26.33
AA seq 189 aa AA seqDB search
MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPS
RFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRW
IARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELID
HSPKATPDN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatgagtttgttgcggcgggtttcggttactgcggtggcagctctgtctggc
cggccccttggcactcgcctcggatttgggggcttcctcactcgtggctttccgaaggct
gctgctcctgttcgacacagtggagaccatgggaaaagactatttgtcatcagaccttct
agattctatgacaggcgttttttgaagttattgagattctacattgcattgactgggatt
ccagtagcaattttcataactctggtgaatgtattcattggtcaagctgaactagcagaa
attccagaaggctatgtcccagaacactgggaatattataagcatcccatatcaagatgg
attgcccgtaatttctatgatagtcctgaaaagatatatgaaagaacaatggccgtcctt
cagattgaagctgaaaaggctgaattacgggtaaaggagctggaagtgcgaaaattgatg
catgtgagaggagatggaccctggtattactatgagacaattgacaaggaacttattgat
cattctccgaaagcaactcctgacaattaa

KEGG   Homo sapiens (human): 4712Help
Entry
4712              CDS       T01001                                 

Gene name
NDUFB6, B17, CI
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B6
  KO
K03962  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4712 (NDUFB6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4712 (NDUFB6)
  09159 Environmental adaptation
   04714 Thermogenesis
    4712 (NDUFB6)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4712 (NDUFB6)
   05012 Parkinson disease
    4712 (NDUFB6)
   05016 Huntington disease
    4712 (NDUFB6)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4712 (NDUFB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B6 Sensor
Motif
Other DBs
NCBI-GeneID: 4712
NCBI-ProteinID: NP_002484
OMIM: 603322
HGNC: 7701
Ensembl: ENSG00000165264
Vega: OTTHUMG00000019741
Pharos: O95139(Tclin)
UniProt: O95139
Structure
PDB: 

Position
9p21.1
AA seq 128 aa AA seqDB search
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKM
VHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPM
KEFPDQHH
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgacggggtacactccggatgagaaactgcggctgcagcagctgcgagagctgagaagg
cgatggctgaaggaccaggagctgagccctcgggagccggtgctgcccccacagaagatg
gggcctatggagaaattctggaataaatttttggagaataaatccccttggaggaaaatg
gtccatggggtatacaaaaagagtatctttgttttcactcatgtacttgtacctgtctgg
attattcattattacatgaagtatcatgtttctgaaaaaccatatggcatagttgaaaag
aagtccagaatattccctggtgatacaattctggagactggagaagtaattccaccaatg
aaagaatttcctgatcaacatcattaa

KEGG   Homo sapiens (human): 4713Help
Entry
4713              CDS       T01001                                 

Gene name
NDUFB7, B18, CI-B18
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B7
  KO
K03963  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4713 (NDUFB7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4713 (NDUFB7)
  09159 Environmental adaptation
   04714 Thermogenesis
    4713 (NDUFB7)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4713 (NDUFB7)
   05012 Parkinson disease
    4713 (NDUFB7)
   05016 Huntington disease
    4713 (NDUFB7)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4713 (NDUFB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B7 OrfB_IS605 Cmc1 Cys_rich_FGFR
Motif
Other DBs
NCBI-GeneID: 4713
NCBI-ProteinID: NP_004137
OMIM: 603842
HGNC: 7702
Ensembl: ENSG00000099795
Vega: OTTHUMG00000183291
Pharos: P17568(Tclin)
UniProt: P17568
Structure
PDB: 

Position
19p13.12
AA seq 137 aa AA seqDB search
MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCA
HHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAA
ELAKGQGPGEVDPKVAL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccacctggtccggcgctacctgggcgatgcctcggtggagcccgaccccctg
cagatgccaaccttcccgccagactacggcttccccgaacgcaaggagcgcgagatggtg
gccacacagcaggagatgatggacgcgcagctgaggctccagctgcgggactactgcgcc
caccacctcatccggctgctcaagtgcaagcgtgacagcttccccaacttcctggcctgc
aagcaggagcggcacgactgggactactgcgagcaccgcgactatgtgatgcgcatgaag
gagtttgagcgggagcggaggctgctccagcggaagaagcggcgggagaagaaggcggca
gagttggccaaaggccagggacccggggaagtggaccccaaggtggccctgtag

KEGG   Homo sapiens (human): 4714Help
Entry
4714              CDS       T01001                                 

Gene name
NDUFB8, ASHI, CI-ASHI
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B8
  KO
K03964  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4714 (NDUFB8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4714 (NDUFB8)
  09159 Environmental adaptation
   04714 Thermogenesis
    4714 (NDUFB8)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4714 (NDUFB8)
   05012 Parkinson disease
    4714 (NDUFB8)
   05016 Huntington disease
    4714 (NDUFB8)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4714 (NDUFB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B8
Motif
Other DBs
NCBI-GeneID: 4714
NCBI-ProteinID: NP_004995
OMIM: 602140
HGNC: 7703
Ensembl: ENSG00000166136
Vega: OTTHUMG00000019346
Pharos: O95169(Tclin)
UniProt: O95169
Structure
PDB: 

Position
10q24.31
AA seq 186 aa AA seqDB search
MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVE
DYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTS
PTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPER
VVHYEI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccagggccggggtcttgggagtccagtggctgcaaagggcatcccggaac
gtgatgccgctgggcgcacggacagcctcccacatgaccaaggacatgttcccggggccc
tatcctaggaccccagaagaacgggccgccgccgccaagaagtataatatgcgtgtggaa
gactacgaaccttacccggatgatggcatggggtatggcgactacccgaagctccctgac
cgctcacagcatgagagagatccatggtatagctgggaccagccgggcctgaggttgaac
tggggtgaaccgatgcactggcacctagacatgtacaacaggaaccgtgtggatacatcc
cccacacctgtttcttggcatgtcatgtgtatgcagctcttcggtttcctggctttcatg
atattcatgtgctgggtgggggacgtgtaccctgtctaccagcctgtgggaccaaagcag
tatccttacaataatctgtacctggaacgaggcggtgatccctccaaagaaccagagcgg
gtggttcactatgagatctga

KEGG   Homo sapiens (human): 4715Help
Entry
4715              CDS       T01001                                 

Gene name
NDUFB9, B22, CI-B22, LYRM3, UQOR22
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B9
  KO
K03965  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4715 (NDUFB9)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4715 (NDUFB9)
  09159 Environmental adaptation
   04714 Thermogenesis
    4715 (NDUFB9)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4715 (NDUFB9)
   05012 Parkinson disease
    4715 (NDUFB9)
   05016 Huntington disease
    4715 (NDUFB9)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4715 (NDUFB9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_LYR Complex1_LYR_2 ImpA_N
Motif
Other DBs
NCBI-GeneID: 4715
NCBI-ProteinID: NP_004996
OMIM: 601445
HGNC: 7704
Ensembl: ENSG00000147684
Vega: OTTHUMG00000165054
Pharos: Q9Y6M9(Tclin)
UniProt: Q9Y6M9
Structure
PDB: 

Position
8q24.13
AA seq 179 aa AA seqDB search
MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKA
TQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFA
KREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcttggcgtcgggaccctacctgacccatcagcaaaaggtgttgcggctttat
aagcgggcgctacgccacctcgagtcgtggtgcgtccagagagacaaataccgatacttt
gcttgtttgatgagagcccggtttgaagaacataagaatgaaaaggatatggcgaaggcc
acccagctgctgaaggaggccgaggaagaattctggtaccgtcagcatccacagccatac
atcttccctgactctcctgggggcacctcctatgagagatacgattgctacaaggtccca
gaatggtgcttagatgactggcatccttctgagaaggcaatgtatcctgattactttgcc
aagagagaacagtggaagaaactgcggagggaaagctgggaacgagaggttaagcagctg
caggaggaaacgccacctggtggtcctttaactgaagctttgccccctgcccgaaaggaa
ggtgatttgcccccactgtggtggtatattgtgaccagaccccgggagcggcccatgtag

KEGG   Homo sapiens (human): 4716Help
Entry
4716              CDS       T01001                                 

Gene name
NDUFB10, PDSW
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B10
  KO
K03966  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4716 (NDUFB10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4716 (NDUFB10)
  09159 Environmental adaptation
   04714 Thermogenesis
    4716 (NDUFB10)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4716 (NDUFB10)
   05012 Parkinson disease
    4716 (NDUFB10)
   05016 Huntington disease
    4716 (NDUFB10)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4716 (NDUFB10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUFB10
Motif
Other DBs
NCBI-GeneID: 4716
NCBI-ProteinID: NP_004539
OMIM: 603843
HGNC: 7696
Ensembl: ENSG00000140990
Vega: OTTHUMG00000128709
Pharos: O96000(Tclin)
UniProt: O96000 A8K761
Structure
PDB: 

Position
16p13.3
AA seq 172 aa AA seqDB search
MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHR
QYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCI
KEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccggacagctgggacaaggatgtgtaccctgagcccccgcgccgcacgccggtgcag
cccaatcccatcgtctacatgatgaaagcgttcgacctcatcgtggaccgacccgtgacc
ctcgtgagagaatttatagagcggcagcacgcaaagaacaggtattactactaccaccgg
cagtaccgccgcgtgccagacatcactgagtgcaaggaggaggacatcatgtgcatgtat
gaagccgaaatgcagtggaagagggactacaaagtcgaccaagaaattatcaacattatg
caggatcggctcaaagcctgtcagcagagggaaggacagaactaccagcagaactgtatc
aaggaagtggagcagttcacccaggtggccaaggcctaccaggaccgctatcaggacctg
ggggcctacagttctgccaggaagtgcctggccaaacagaggcagaggatgctgcaagag
agaaaagctgcaaaagaggccgccgctgccacctcctga

KEGG   Homo sapiens (human): 4717Help
Entry
4717              CDS       T01001                                 

Gene name
NDUFC1, KFYI
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit C1
  KO
K03967  NADH dehydrogenase (ubiquinone) 1 subunit C1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4717 (NDUFC1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4717 (NDUFC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4717 (NDUFC1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4717 (NDUFC1)
   05012 Parkinson disease
    4717 (NDUFC1)
   05016 Huntington disease
    4717 (NDUFC1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4717 (NDUFC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADH_dh_m_C1
Motif
Other DBs
NCBI-GeneID: 4717
NCBI-ProteinID: NP_001171915
OMIM: 603844
HGNC: 7705
Ensembl: ENSG00000109390
Vega: OTTHUMG00000133387
Pharos: O43677(Tclin)
UniProt: O43677
Structure
PDB: 

Position
4q31.1
AA seq 76 aa AA seqDB search
MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIK
QHNEDILEYKRRNGLE
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtccgccttgctgcgtcccctttcccggctgctggcccccgccaggctcccg
agcggcccttcagtgcgatcaaagttctacgtgcgagagccgccgaatgccaaacctgac
tggctgaaagttgggttcaccttgggcaccactgtcttcttgtggatctatctcatcaaa
caacacaatgaagatattttagagtacaaaagaagaaatgggctggaataa

KEGG   Homo sapiens (human): 4718Help
Entry
4718              CDS       T01001                                 

Gene name
NDUFC2, B14.5b, CI-B14.5b, HLC-1, NADHDH2
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit C2
  KO
K03968  NADH dehydrogenase (ubiquinone) 1 subunit C2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4718 (NDUFC2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4718 (NDUFC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4718 (NDUFC2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4718 (NDUFC2)
   05012 Parkinson disease
    4718 (NDUFC2)
   05016 Huntington disease
    4718 (NDUFC2)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4718 (NDUFC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_C2
Motif
Other DBs
NCBI-GeneID: 4718
NCBI-ProteinID: NP_004540
OMIM: 603845
HGNC: 7706
Ensembl: ENSG00000151366
Vega: OTTHUMG00000166614
Pharos: O95298(Tclin)
UniProt: O95298 A0A024R5K6
Structure
PDB: 

Position
11q14.1
AA seq 119 aa AA seqDB search
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ
LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcacggcggaacccagaacccttacggtttctgccggatgaggcccggagcctg
cccccgcccaagctgaccgacccgcggctcctctacatcggcttcttgggctactgctcc
ggcctgattgataacctaatccggcggaggccgatcgcgacggctggtttgcatcgccag
cttctatatattacggcctttttttttgctggatattatcttgtaaaacgtgaagactac
ctgtatgctgtgagggaccgtgaaatgtttggatatatgaaattacatccagaggatttt
cctgaagaagataagaaaacatatggtgaaatttttgaaaaattccatccaatacgttga

KEGG   Homo sapiens (human): 4719Help
Entry
4719              CDS       T01001                                 

Gene name
NDUFS1, CI-75Kd, CI-75k, PRO1304
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S1
  KO
K03934  NADH dehydrogenase (ubiquinone) Fe-S protein 1 [EC:1.6.5.3 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4719 (NDUFS1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4719 (NDUFS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4719 (NDUFS1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4719 (NDUFS1)
   05012 Parkinson disease
    4719 (NDUFS1)
   05016 Huntington disease
    4719 (NDUFS1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4719 (NDUFS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4719 (NDUFS1)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     4719 (NDUFS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Molybdopterin Fer2_4 NADH-G_4Fe-4S_3 NADH_dhqG_C Fer2
Motif
Other DBs
NCBI-GeneID: 4719
NCBI-ProteinID: NP_004997
OMIM: 157655
HGNC: 7707
Ensembl: ENSG00000023228
Vega: OTTHUMG00000132892
Pharos: P28331(Tclin)
UniProt: P28331 E5KRK5
Structure
PDB: 

Position
2q33.3
AA seq 727 aa AA seqDB search
MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNR
VDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSA
LQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKN
PPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
GANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSIC
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggatacctgtaagaaaggccttagtaggcctttctaagtctcctaaaggatgt
gttcgaacaactgccacagcagcaagcaacttgattgaagtatttgttgatggtcagtct
gtcatggtggaaccgggaacgaccgtcctccaagcttgtgagaaggttggcatgcagatc
cctcgattctgttatcatgaaaggttgtctgttgctggaaactgcaggatgtgccttgtt
gaaattgagaaagcccctaaggttgtagctgcttgtgccatgccagtaatgaagggttgg
aatatcctaacaaactcagaaaaatccaaaaaagccagggaaggtgtgatggagttctta
ttagcaaatcacccattggactgtcctatttgtgaccagggaggtgaatgtgatctgcag
gaccagtccatgatgtttggaaatgataggagccgatttttagaggggaagcgtgctgtg
gaagacaagaacattgggccattggtaaagaccatcatgacaagatgtatacagtgtact
cgctgcatcaggtttgcaagtgagattgcaggagtagatgatttgggaacaacaggcaga
ggaaatgatatgcaagttggcacatacattgaaaagatgttcatgtctgaactgtctggg
aatatcattgatatctgccctgtaggtgccctaacctctaagccctatgcctttactgcc
cggccttgggaaacaagaaagacagaatccattgatgtaatggatgcggttggaagtaat
attgtggttagcacaagaactggagaagtgatgaggattttgccacgtatgcatgaggac
atcaatgaagagtggatctctgataaaaccagatttgcctatgatgggctaaaacgtcaa
agacttaccgagccaatggtcagaaatgaaaaagggcttttaacctatacttcttgggag
gatgcgctctctcgcgtagctggaatgttgcagagttttcaaggcaaagatgtggcagca
attgcaggtggcttggtggatgctgaagccctggtagctctcaaagatttgcttaataga
gtggactctgacaccttatgcactgaagaggtcttccccactgcaggagctggcacagat
ttgcgttccaattatcttcttaatactacaattgctggtgtggaagaggcagatgttgtt
cttctggttggtacaaacccacgttttgaggcaccactgtttaatgctagaattcgaaag
agctggctgcataatgacttaaaagtggcccttataggcagtccagtggacctcacttac
acatatgaccacctgggagactcccccaaaattcttcaagacattgcttcgggaagccat
ccatttagccaggtcctaaaggaagctaaaaaaccaatggtggttttaggcagttctgca
ctccaaagaaatgatggagcagcaattcttgcagctgtttctagcattgcacaaaagatt
cggatgactagtggtgttactggtgattggaaagttatgaatatccttcataggattgca
agtcaagtagctgctttggaccttggctataagcctggggtggaagcaattcggaagaac
cctcccaaggtgctgtttctcctgggagcagatggaggttgtatcacacgacaggatttg
ccaaaggattgtttcattatttatcaaggacatcatggtgatgttggggctcccatagct
gatgttattctcccaggagctgcttacacagagaagtctgctacatatgtcaacactgag
ggtagagctcagcagactaaggtagcagtgacacctcctggcttggcaagagaagactgg
aaaattataagagcactctctgagattgctggaatgactcttccatatgatactctggat
caagtaaggaacagattggaagaagtctctcctaatcttgttcgatatgatgatattgaa
ggggctaattacttccagcaagcaaatgagctctcaaagctagtgaaccagcagcttctt
gctgacccacttgttccacctcagctaactataaaagacttctacatgacagattcaatt
agcagagcctcacagacaatggccaaatgtgtcaaagctgtcacagagggtgcccaggca
gtagaggaaccatccatatgctga

KEGG   Homo sapiens (human): 4720Help
Entry
4720              CDS       T01001                                 

Gene name
NDUFS2, CI-49
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S2
  KO
K03935  NADH dehydrogenase (ubiquinone) Fe-S protein 2 [EC:1.6.5.3 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4720 (NDUFS2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4720 (NDUFS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4720 (NDUFS2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4720 (NDUFS2)
   05012 Parkinson disease
    4720 (NDUFS2)
   05016 Huntington disease
    4720 (NDUFS2)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4720 (NDUFS2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4720 (NDUFS2)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     4720 (NDUFS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_49kDa NiFeSe_Hases
Motif
Other DBs
NCBI-GeneID: 4720
NCBI-ProteinID: NP_004541
OMIM: 602985
HGNC: 7708
Ensembl: ENSG00000158864
Vega: OTTHUMG00000034344
Pharos: O75306(Tclin)
UniProt: O75306
Structure
PDB: 

Position
1q23.3
AA seq 463 aa AA seqDB search
MAALRALCGFRGVAAQVLRPGAGVRLPIQPSRGVRQWQPDVEWAQQFGGAVMYPSKETAH
WKPPPWNDVDPPKDTIVKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGT
EKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRL
LNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGL
MDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQW
DLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDD
AKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPY
RCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgagggctttgtgcggcttccggggcgtcgcggcccaggtgctgcggcct
ggggctggagtccgattgccgattcagcccagcagaggtgttcggcagtggcagccagat
gtggaatgggcacagcagtttgggggagctgttatgtacccaagcaaagaaacagcccac
tggaagcctccaccttggaatgatgtggaccctccaaaggacacaattgtgaagaacatt
accctgaactttgggccccaacacccagcagcgcatggtgtcctgcgactagtgatggaa
ttgagtggggagatggtgcggaagtgtgatcctcacatcgggctcctgcaccgaggcact
gagaagctcattgaatacaagacctatcttcaggcccttccatactttgaccggctagac
tatgtgtccatgatgtgtaacgaacaggcctattctctagctgtggagaagttgctaaac
atccggcctcctcctcgggcacagtggatccgagtgctgtttggagaaatcacacgtttg
ttgaaccacatcatggctgtgaccacacatgccctggaccttggggccatgacccctttc
ttctggctgtttgaagaaagggagaagatgtttgagttctacgagcgagtgtctggagcc
cgaatgcatgctgcttatatccggccaggaggagtgcaccaggacctaccccttgggctt
atggatgacatttatcagttttctaagaacttctctcttcggcttgatgagttggaggag
ttgctgaccaacaataggatctggcgaaatcggacaattgacattggggttgtaacagca
gaagaagcacttaactatggttttagtggagtgatgcttcggggctcaggcatccagtgg
gacctgcggaagacccagccctatgatgtttacgaccaggttgagtttgatgttcctgtt
ggttctcgaggggactgctatgataggtacctgtgccgggtggaggagatgcgccagtcc
ctgagaattatcgcacagtgtctaaacaagatgcctcctggggagatcaaggttgatgat
gccaaagtgtctccacctaagcgagcagagatgaagacttccatggagtcactgattcat
cactttaagttgtatactgagggctaccaagttcctccaggagccacatatactgccatt
gaggctcccaagggagagtttggggtgtacctggtgtctgatggcagcagccgcccttat
cgatgcaagatcaaggctcctggttttgcccatctggctggtttggacaagatgtctaag
ggacacatgttggcagatgtcgttgccatcataggtacccaagatattgtatttggagaa
gtagatcggtga

KEGG   Homo sapiens (human): 4722Help
Entry
4722              CDS       T01001                                 

Gene name
NDUFS3, CI-30
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S3
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:1.6.5.3 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4722 (NDUFS3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4722 (NDUFS3)
  09159 Environmental adaptation
   04714 Thermogenesis
    4722 (NDUFS3)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4722 (NDUFS3)
   05012 Parkinson disease
    4722 (NDUFS3)
   05016 Huntington disease
    4722 (NDUFS3)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4722 (NDUFS3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4722 (NDUFS3)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     4722 (NDUFS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 4722
NCBI-ProteinID: NP_004542
OMIM: 603846
HGNC: 7710
Ensembl: ENSG00000213619
Vega: OTTHUMG00000166893
Pharos: O75489(Tclin)
UniProt: O75489
Structure
PDB: 

Position
11p11.2
AA seq 264 aa AA seqDB search
MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSA
FGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVP
TRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFAN
HPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWE
AFPVYRQPPESLKLEAGDKKPDAK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggtagccaggctgtggtggcgcgggatcttgggggcctcggcgctg
accagggggactgggcgaccctccgttctgttgctgccggtgaggcgggagagcgccggg
gccgacacgcgccccactgtcagaccacggaatgatgtggcccacaagcagctctcagct
tttggagagtatgtggctgaaatcttgcccaagtatgtccaacaagttcaggtgtcctgc
ttcaatgagttagaggtctgtatccatcctgatggcgtcatcccagtgctgactttcctc
agggatcacaccaatgcacagttcaaatctctggttgacttgacagcagtggacgtccca
actcggcaaaaccgttttgagattgtctacaacctgttgtctctgcgcttcaactcacgg
atccgtgtgaagacctacacagatgagctgacgcccattgagtctgctgtctctgtgttc
aaggcagccaactggtatgaaagggagatctgggacatgtttggagtcttctttgctaac
caccctgatctaagaaggatcctgacagattatggcttcgagggacatcctttccggaaa
gactttcctctatctggctatgttgagttacgttatgatgatgaagtgaagcgggtggtg
gcagagccggtggagttggcccaagagttccgcaaatttgacctgaacagcccctgggag
gctttcccagtctatcgccaacccccggagagtctcaagcttgaagccggagacaagaag
cctgatgccaagtag

KEGG   Homo sapiens (human): 4723Help
Entry
4723              CDS       T01001                                 

Gene name
NDUFV1, CI-51K, CI51KD, UQOR1
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit V1
  KO
K03942  NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:1.6.5.3 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4723 (NDUFV1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4723 (NDUFV1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4723 (NDUFV1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4723 (NDUFV1)
   05012 Parkinson disease
    4723 (NDUFV1)
   05016 Huntington disease
    4723 (NDUFV1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4723 (NDUFV1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4723 (NDUFV1)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     4723 (NDUFV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Motif
Other DBs
NCBI-GeneID: 4723
NCBI-ProteinID: NP_009034
OMIM: 161015
HGNC: 7716
Ensembl: ENSG00000167792
Vega: OTTHUMG00000166215
Pharos: P49821(Tclin)
UniProt: P49821 E5KNH5
Structure
PDB: 

Position
11q13.2
AA seq 464 aa AA seqDB search
MLATRRLLGWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRG
DWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaacacggcggctgctcggctggtcgcttcccgcgcgggtatctgtgcgtttc
agcggcgacacgacagcacccaagaaaacctcatttggctcgctgaaggatgaagaccgg
attttcaccaacctgtacggccgccatgactggaggctgaaaggttccctgagtcgaggt
gactggtacaagacaaaggagatcctgctgaaggggcccgactggatcctgggcgagatc
aagacatcgggtttgaggggccgtggaggcgctggcttccccactggcctcaagtggagc
ttcatgaataagccctcagatggcaggcccaagtatctggtggtgaacgcagacgagggg
gagccgggcacctgcaaggaccgggagatcttacgccatgatcctcacaagctgctggaa
ggctgcctggtggggggccgggccatgggcgcccgcgctgcctatatctacatccgaggg
gaattctacaatgaggcctccaatctgcaggtggccatccgagaggcctatgaggcaggt
ctgattggcaagaatgcttgtggctctggctatgattttgacgtgtttgtggtgcgcggg
gctggggcctacatctgtggagaggagacagcgctcatcgagtccattgagggcaagcag
ggcaagccccgcctgaagccccccttccccgcagacgtgggagtgtttggctgccccaca
actgtggccaacgtggagacagtggcagtgtcccccacaatctgccgccgtggaggtacc
tggtttgctggctttggcagagaacgcaactcaggcaccaaactattcaacatctctggc
catgtcaaccacccttgcactgtggaggaggagatgtctgtgcccttgaaagaactgatt
gagaagcatgctgggggtgtcacgggcggctgggacaacctccttgctgtgatccctggc
ggctcgtctaccccactgatccccaagtctgtgtgtgagacggtgctgatggacttcgat
gcgctggtgcaggcacagacaggcctgggcacagctgcggtgatcgtcatggaccgctcg
acggacatcgtgaaagccatcgcccgcctcattgagttctataagcacgagagctgtggc
cagtgtaccccatgccgtgagggtgtggactggatgaacaaggtgatggcacgtttcgtg
aggggggatgcccggccggccgagatcgactccctgtgggagatcagcaagcagatagaa
ggccatacgatttgtgctctgggtgacggggccgcctggcctgtgcagggtctgatccgc
cactttcggccggagctcgaggagcggatgcagcggtttgcccagcagcatcaggcccgg
caggctgcctcttag

KEGG   Homo sapiens (human): 4724Help
Entry
4724              CDS       T01001                                 

Gene name
NDUFS4, AQDQ, CI-18, CI-18_kDa, CI-AQDQ
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit S4
  KO
K03937  NADH dehydrogenase (ubiquinone) Fe-S protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4724 (NDUFS4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4724 (NDUFS4)
  09159 Environmental adaptation
   04714 Thermogenesis
    4724 (NDUFS4)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4724 (NDUFS4)
   05012 Parkinson disease
    4724 (NDUFS4)
   05016 Huntington disease
    4724 (NDUFS4)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4724 (NDUFS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETC_C1_NDUFA4
Motif
Other DBs
NCBI-GeneID: 4724
NCBI-ProteinID: NP_002486
OMIM: 602694
HGNC: 7711
Ensembl: ENSG00000164258
Vega: OTTHUMG00000096987
Pharos: O43181(Tclin)
UniProt: O43181 A0A0S2Z433
Structure
PDB: 

Position
5q11.2
AA seq 175 aa AA seqDB search
MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLD
ITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADP
LSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgtcaatgtcagtggtactgaggcagacgttgtggcggagaagggcagtg
gctgtagctgccctttccgtttccagggttccgaccaggtcgttgaggacttccacatgg
agattggcacaggaccagactcaagacacacaactcataacagttgatgaaaaattggat
atcactactttaactggagttccagaagagcatataaaaactagaaaagtcaggatcttt
gttcctgctcgcaataacatgcagtctggagtaaacaacacaaagaaatggaagatggag
tttgataccagagagcgatgggaaaatcctttgatgggttgggcatcaacggctgatccc
ttatccaacatggttctaaccttcagtactaaagaagatgcagtttcctttgcagaaaaa
aatggatggagctatgacattgaagagaggaaggttccaaaacccaagtccaagtcttat
ggtgcaaacttttcttggaacaaaagaacaagagtatccacaaaatag

KEGG   Homo sapiens (human): 4725Help
Entry
4725              CDS       T01001                                 

Gene name
NDUFS5, CI-15k, CI15K
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit S5
  KO
K03938  NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4725 (NDUFS5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4725 (NDUFS5)
  09159 Environmental adaptation
   04714 Thermogenesis
    4725 (NDUFS5)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4725 (NDUFS5)
   05012 Parkinson disease
    4725 (NDUFS5)
   05016 Huntington disease
    4725 (NDUFS5)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4725 (NDUFS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ndufs5 Cmc1
Motif
Other DBs
NCBI-GeneID: 4725
NCBI-ProteinID: NP_001171908
OMIM: 603847
HGNC: 7712
Ensembl: ENSG00000168653
Vega: OTTHUMG00000007497
Pharos: O43920(Tclin)
UniProt: O43920 Q6IBA0
Structure
PDB: 

Position
1p34.3
AA seq 106 aa AA seqDB search
MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY
DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcttggacatccagaaaaggttcggccttaacatagatcgatggttgacaatc
cagagtggtgaacagccctacaagatggctggtcgatgccatgcttttgaaaaagaatgg
atagaatgtgcacatggaatcggttatactcgggcagagaaagagtgcaagatagaatat
gatgatttcgtagagtgtttgcttcggcagaaaacgatgagacgtgcaggtaccatcagg
aagcagcgggataagctgataaaggaaggaaagtacacccctccacctcaccacattggc
aagggggagcctcggccctga

KEGG   Homo sapiens (human): 4726Help
Entry
4726              CDS       T01001                                 

Gene name
NDUFS6, CI-13kA, CI-13kD-A, CI13KDA
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit S6
  KO
K03939  NADH dehydrogenase (ubiquinone) Fe-S protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4726 (NDUFS6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4726 (NDUFS6)
  09159 Environmental adaptation
   04714 Thermogenesis
    4726 (NDUFS6)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4726 (NDUFS6)
   05012 Parkinson disease
    4726 (NDUFS6)
   05016 Huntington disease
    4726 (NDUFS6)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4726 (NDUFS6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CHCC Thiolase_C
Motif
Other DBs
NCBI-GeneID: 4726
NCBI-ProteinID: NP_004544
OMIM: 603848
HGNC: 7713
Ensembl: ENSG00000145494
Vega: OTTHUMG00000090372
Pharos: O75380(Tclin)
UniProt: O75380 Q6IBC4
Structure
PDB: 

Position
5p15.33
AA seq 124 aa AA seqDB search
MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQ
KEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFR
QHHH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgatgaccttctgccggctgctgaaccggtgtggcgaggcggcgcggagc
ctgcccctgggcgccaggtgtttcggggtgcgggtctcgccgaccggggagaaggtcacg
cacactggccaggtttatgatgataaagactacaggagaattcggtttgtaggtcgtcag
aaagaggtgaatgaaaactttgccattgatttgatagcagagcagcccgtgagcgaggtg
gagactcgggtgatagcgtgcgatggcggcgggggagctcttggccacccaaaagtgtat
ataaacttggacaaagaaacaaaaaccggcacatgcggttactgtgggctccagttcaga
cagcaccaccactag

KEGG   Homo sapiens (human): 4728Help
Entry
4728              CDS       T01001                                 

Gene name
NDUFS8, CI-23k, CI23KD, TYKY
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S8
  KO
K03941  NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:1.6.5.3 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4728 (NDUFS8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4728 (NDUFS8)
  09159 Environmental adaptation
   04714 Thermogenesis
    4728 (NDUFS8)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4728 (NDUFS8)
   05012 Parkinson disease
    4728 (NDUFS8)
   05016 Huntington disease
    4728 (NDUFS8)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4728 (NDUFS8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4728 (NDUFS8)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     4728 (NDUFS8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_16 Fer4_21 Fer4_9 Fer4_10 Fer4_6 Fer4_8 Fer4_2 Fer4_4 Fer4_17 c-SKI_SMAD_bind Fer4_13 Fer4_18 Fer4_3
Motif
Other DBs
NCBI-GeneID: 4728
NCBI-ProteinID: NP_002487
OMIM: 602141
HGNC: 7715
Ensembl: ENSG00000110717
Vega: OTTHUMG00000167331
Pharos: O00217(Tclin)
UniProt: O00217
Structure
PDB: 

Position
11q13.2
AA seq 210 aa AA seqDB search
MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLL
WTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAI
CPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEE
LLYNKEKLLNNGDKWEAEIAANIQADYLYR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgcctgaccacgcctatgctgctgcgggccctggcccaggctgcacgtgcagga
cctcctggtggccggagcctccacagcagtgcagtggcagccacctacaagtatgtgaac
atgcaggatcccgagatggacatgaagtcagtgactgaccgggcagcccgcaccctgctg
tggactgagctcttccgaggcctgggcatgaccctgagctacctgttccgggaaccggcc
accatcaactacccgttcgagaagggcccgctgagccctcgcttccgtggggagcatgcg
ctgcgccggtacccatccggggaggagcgttgcattgcctgcaagctctgcgaggccatc
tgccccgcccaggccatcaccatcgaggctgagccaagagctgatggcagccgccggacc
acccgctatgacatcgacatgaccaagtgcatctactgcggcttctgccaggaggcctgt
cccgtggatgccatcgtcgagggccccaactttgagttctccacggagacccatgaggag
ctgctgtacaacaaggagaagttgctcaacaacggggacaagtgggaggccgagatcgcc
gccaacatccaggctgactacttgtatcggtga

KEGG   Homo sapiens (human): 4729Help
Entry
4729              CDS       T01001                                 

Gene name
NDUFV2, CI-24k
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit V2
  KO
K03943  NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:1.6.5.3 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4729 (NDUFV2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4729 (NDUFV2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4729 (NDUFV2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4729 (NDUFV2)
   05012 Parkinson disease
    4729 (NDUFV2)
   05016 Huntington disease
    4729 (NDUFV2)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4729 (NDUFV2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4729 (NDUFV2)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     4729 (NDUFV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2Fe-2S_thioredx
Motif
Other DBs
NCBI-GeneID: 4729
NCBI-ProteinID: NP_066552
OMIM: 600532
HGNC: 7717
Ensembl: ENSG00000178127
Vega: OTTHUMG00000131593
Pharos: P19404(Tclin)
UniProt: P19404
Structure
PDB: 

Position
18p11.22
AA seq 249 aa AA seqDB search
MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENY
KRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT
MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC
VNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG
PGFGVQAGL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctccgcggcgctccgggcccgggcggctggcctcaccgcccactggggaaga
catgtaaggaatttgcataagacagttatgcaaaatggagctggaggagctttatttgtg
cacagagatactcctgagaataaccctgatactccatttgatttcacaccagaaaactat
aagaggatagaggcaattgtaaaaaactatccagaaggccataaagcagcagctgttctt
ccagtcctggatttagcccaaaggcagaatgggtggttgcccatctctgctatgaacaag
gttgcagaagttttacaagtacctccaatgagagtatatgaagtagcaactttttataca
atgtataatcgaaagccagttggaaagtatcacattcaggtctgcactactacaccctgc
atgcttcgaaactctgacagcatactggaggccattcagaaaaagcttggaataaaggtt
ggggagactacacctgacaaacttttcactcttatagaagtggaatgtttaggggcctgt
gtgaacgcaccaatggttcaaataaatgacaattactatgaggatttgacagctaaggat
attgaagaaattattgatgagctcaaggctggcaaaatcccaaaaccagggccaaggagt
ggacgcttctcttgtgagccagctggaggtcttacctctttgactgaaccacccaaggga
cctggatttggtgtacaagcaggcctttaa

KEGG   Homo sapiens (human): 4731Help
Entry
4731              CDS       T01001                                 

Gene name
NDUFV3, CI-10k, CI-9KD
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit V3
  KO
K03944  NADH dehydrogenase (ubiquinone) flavoprotein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4731 (NDUFV3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4731 (NDUFV3)
  09159 Environmental adaptation
   04714 Thermogenesis
    4731 (NDUFV3)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4731 (NDUFV3)
   05012 Parkinson disease
    4731 (NDUFV3)
   05016 Huntington disease
    4731 (NDUFV3)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4731 (NDUFV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUFV3
Motif
Other DBs
NCBI-GeneID: 4731
NCBI-ProteinID: NP_001001503
OMIM: 602184
HGNC: 7719
Ensembl: ENSG00000160194
Vega: OTTHUMG00000086823
Pharos: P56181(Tclin)
UniProt: P56181
Structure
PDB: 

Position
21q22.3
AA seq 108 aa AA seqDB search
MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAP
VPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccgtgtttgctgcggcaaggacgagccggggcgctgaagactatgctccag
gaagcccaggtgtttcgaggacttgcttctacggtttctttgtctgcggaatcagggaag
agtgaaaagggtcagccacagaattccaagaagcaaagtccaccaaaaaagccagcccca
gtgcctgctgagccgtttgacaacactacctacaagaacctgcagcatcatgactacagc
acgtacaccttcttagacctcaacctcgaactctcaaaattcaggatgcctcagccctcc
tcaggccgggagtcacctcgacactga

KEGG   Homo sapiens (human): 51079Help
Entry
51079             CDS       T01001                                 

Gene name
NDUFA13, B16.6, CDA016, CGI-39, GRIM-19, GRIM19
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A13
  KO
K11353  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    51079 (NDUFA13)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    51079 (NDUFA13)
  09159 Environmental adaptation
   04714 Thermogenesis
    51079 (NDUFA13)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    51079 (NDUFA13)
   05012 Parkinson disease
    51079 (NDUFA13)
   05016 Huntington disease
    51079 (NDUFA13)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51079 (NDUFA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GRIM-19 COX14
Motif
Other DBs
NCBI-GeneID: 51079
NCBI-ProteinID: NP_057049
OMIM: 609435
HGNC: 17194
Ensembl: ENSG00000186010
Vega: OTTHUMG00000162211
Pharos: Q9P0J0(Tclin)
UniProt: Q9P0J0
Structure
PDB: 

Position
19p13.11
AA seq 144 aa AA seqDB search
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRL
QIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPL
IGELYGLRTTEEALHASHGFMWYT
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcaaaggtgaagcaggacatgcctccgccggggggctatgggcccatcgac
tacaaacggaacttgccgcgtcgaggactgtcgggctacagcatgctggccatagggatt
ggaaccctgatctacgggcactggagcataatgaagtggaaccgtgagcgcaggcgccta
caaatcgaggacttcgaggctcgcatcgcgctgttgccactgttacaggcagaaaccgac
cggaggaccttgcagatgcttcgggagaacctggaggaggaggccatcatcatgaaggac
gtgcccgactggaaggtgggggagtctgtgttccacacaacccgctgggtgccccccttg
atcggggagctgtacgggctgcgcaccacagaggaggctctccatgccagccacggcttc
atgtggtacacgtag

KEGG   Homo sapiens (human): 54539Help
Entry
54539             CDS       T01001                                 

Gene name
NDUFB11, CI-ESSS, ESSS, NP17.3, Np15, P17.3
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B11
  KO
K11351  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Disease
H01904  Microphthalmia with linear skin defects (MLS) syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    54539 (NDUFB11)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    54539 (NDUFB11)
  09159 Environmental adaptation
   04714 Thermogenesis
    54539 (NDUFB11)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    54539 (NDUFB11)
   05012 Parkinson disease
    54539 (NDUFB11)
   05016 Huntington disease
    54539 (NDUFB11)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    54539 (NDUFB11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ESSS
Motif
Other DBs
NCBI-GeneID: 54539
NCBI-ProteinID: NP_001129470
OMIM: 300403
HGNC: 20372
Ensembl: ENSG00000147123
Vega: OTTHUMG00000021433
Pharos: Q9NX14(Tclin)
UniProt: Q9NX14
Structure
PDB: 

Position
Xp11.3
AA seq 153 aa AA seqDB search
MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPE
PEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRR
EAERLVKYREANGLPIMESNCFDPSKIQLPEDE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgggctgtttggtttgagcgctcgccgtcttttggcggcagcggcgacgcga
gggctcccggccgcccgcgtccgctgggaatctagcttctccaggactgtggtcgccccg
tccgctgtggcgggaaagcggcccccagaaccgaccacaccgtggcaagaggacccagaa
cccgaggacgaaaacttgtatgagaagaacccagactcccatggttatgacaaggacccc
gttttggacgtctggaacatgcgacttgtcttcttctttggcgtctccatcatcctggtc
cttggcagcacctttgtggcctatctgcctgactacaggatgaaagagtggtcccgccgc
gaagctgagaggcttgtgaaataccgagaggccaatggccttcccatcatggaatccaac
tgcttcgaccccagcaagatccagctgccagaggatgagtga

KEGG   Homo sapiens (human): 55967Help
Entry
55967             CDS       T01001                                 

Gene name
NDUFA12, B17.2, DAP13
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A12
  KO
K11352  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    55967 (NDUFA12)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    55967 (NDUFA12)
  09159 Environmental adaptation
   04714 Thermogenesis
    55967 (NDUFA12)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    55967 (NDUFA12)
   05012 Parkinson disease
    55967 (NDUFA12)
   05016 Huntington disease
    55967 (NDUFA12)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    55967 (NDUFA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUFA12
Motif
Other DBs
NCBI-GeneID: 55967
NCBI-ProteinID: NP_061326
OMIM: 614530
HGNC: 23987
Ensembl: ENSG00000184752
Vega: OTTHUMG00000170098
Pharos: Q9UI09(Tclin)
UniProt: Q9UI09
Structure
PDB: 

Position
12q22
AA seq 145 aa AA seqDB search
MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHR
WVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGT
PEQYVPYSTTRKKIQEWIPPSTPYK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggagttagtgcaggtcctgaaacgcgggctgcagcagatcaccggccacggcggtctc
cgaggctatctacgggtttttttcaggacaaatgatgcgaaggttggtacattagtgggg
gaagacaaatatggaaacaaatactatgaagacaacaagcaattttttggccgtcaccga
tgggttgtatatactactgaaatgaatggcaaaaacacattctgggatgtggatggaagc
atggtgcctcctgaatggcatcgttggcttcacagtatgactgatgatcctccaacaaca
aaaccacttactgctcgtaaattcatttggacgaaccataaattcaacgtgactggcacc
ccagaacaatatgtaccttattctaccactagaaagaagattcaggagtggatcccacct
tcaacaccttacaagtaa

KEGG   Homo sapiens (human): 56901Help
Entry
56901             CDS       T01001                                 

Gene name
NDUFA4L2, NUOMS
Definition
(RefSeq) NDUFA4, mitochondrial complex associated like 2
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    56901 (NDUFA4L2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    56901 (NDUFA4L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    56901 (NDUFA4L2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    56901 (NDUFA4L2)
   05012 Parkinson disease
    56901 (NDUFA4L2)
   05016 Huntington disease
    56901 (NDUFA4L2)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    56901 (NDUFA4L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B12D
Motif
Other DBs
NCBI-GeneID: 56901
NCBI-ProteinID: NP_064527
HGNC: 29836
Ensembl: ENSG00000185633
Vega: OTTHUMG00000171275
Pharos: Q9NRX3(Tclin)
UniProt: Q9NRX3 A0A024RB39
Position
12q13.3
AA seq 87 aa AA seqDB search
MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWN
RLSPNDQYKFLAVSTDYKKLKKDRPDF
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagccagtcttggggcccgcttctaccggcagatcaaaagacatccggggatc
atcccgatgatcggcttaatctgcctgggcatgggcagcgctgcgctttacttgctgcga
ctcgcccttcgcagccccgacgtctgctgggacagaaagaacaacccggagccctggaac
cgcctgagccccaatgaccaatacaagttccttgcagtttccactgactataagaagctg
aagaaggaccggccagacttctaa

DBGET integrated database retrieval system