KEGG   Homo sapiens (human): 100533177Help
Entry
100533177         CDS       T01001                                 

Gene name
KRTAP29-1, KAP29.2
Definition
(RefSeq) keratin associated protein 29-1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_B2_2 PMG Keratin_B2
Motif
Other DBs
NCBI-GeneID: 100533177
NCBI-ProteinID: NP_001244238
HGNC: 34211
Ensembl: ENSG00000212658
Vega: OTTHUMG00000133662
Pharos: A8MX34(Tdark)
UniProt: A8MX34
Position
17q21.2
AA seq 341 aa AA seqDB search
MADGCCPGNTTAIPAVPTITTYPVKGGFRHALCLPSSCHSRMWQLVTCQESCQPSIGAPS
GCDPASCQPTRLPATSCVGFVCQPMCSHAACYQSGTGQSPCLVSSCQPSCSESTCCQEKC
CDASPCQQSSCQESVCMSGSCQAACGQSVCCDAGSCQPSCSEVTSCPETSCLPTICTASP
CQPTWCQGSSCQPVSGEGQPCKSTYYQPICYIFKPCQSALYMPVPCQPSTCVFSSCNTTC
CVPSHCQPPHCQLVPSTCFIYQPVANCQAPCSTKNCCKPASCDTVISGQPTCDGPPSYNQ
SGCKSACCVTGLGTSPSSGSNCLPTSCQPSCESSFCKATLC
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcagacggctgttgtcctggaaacaccacagccattccagctgtgcccaccatcacc
acatacccagttaaaggtggatttcgacatgctctctgtttgcctagttcctgccacagc
agaatgtggcaactggtcacatgccaagaaagctgtcagccatccattggtgccccaagt
ggctgtgatcctgcttcgtgtcaacctacccgccttccagcaacgtcttgtgtgggtttt
gtttgccaacctatgtgctcccacgcagcctgctatcagtctggcactggtcagtctcct
tgtctggttagctcatgtcagccatcctgctcggaatctacttgttgtcaggaaaagtgc
tgcgatgccagtccctgccagcaaagctcctgccaggaatctgtctgcatgtctggatca
tgtcaggcagcttgtggccaatcagtctgctgtgatgctggatcctgccagccatcctgc
tctgaagtgacctcctgtccggaaacttcttgcctaccaaccatctgtacagctagtcca
tgccaaccaacttggtgccaaggaagttcatgtcaacccgtcagtggtgaaggccagccc
tgtaaatcaacttattatcaacccatctgctatattttcaagccttgccaatcagccctc
tacatgcctgttccctgccagccatcgacttgtgtgttcagttcttgcaatactacttgc
tgtgtgccttcccattgccagccacctcactgccaactggttccttccacatgcttcatc
taccagccagtggctaactgccaggccccttgttccacaaagaactgttgcaaaccagct
tcttgtgacactgtgatttctggccaaccaacttgtgatggacccccttcctataaccag
agtggctgcaaatcagcttgctgtgtgactggtttaggcacatcacccagtagtggctcc
aattgcttgccgacttcatgccaacccagctgtgagtccagcttctgcaaggcaacactt
tgttaa

DBGET integrated database retrieval system