KEGG   Homo sapiens (human): 10055Help
Entry
10055             CDS       T01001                                 

Gene name
SAE1, AOS1, HSPC140, SUA1, UBLE1A
Definition
(RefSeq) SUMO1 activating enzyme subunit 1
  KO
K10684  ubiquitin-like 1-activating enzyme E1 A [EC:6.2.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10055 (SAE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10055 (SAE1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     10055 (SAE1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   10055 (SAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ThiF
Motif
Other DBs
NCBI-GeneID: 10055
NCBI-ProteinID: NP_005491
OMIM: 613294
HGNC: 30660
Ensembl: ENSG00000142230
Vega: OTTHUMG00000183464
Pharos: Q9UBE0(Tbio)
UniProt: Q9UBE0 A0A024R0R4
Structure
PDB: 

Position
19q13.32
AA seq 346 aa AA seqDB search
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGV
KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE
SFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDY
FLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMA
PVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaaggaggaggctggcggcggcattagcgaggaggaggcggcacagtatgac
cggcagatccgcctgtggggactggaggcccagaaacggctgcgggcctctcgggtgctt
cttgtcggcttgaaaggacttggggctgaaattgccaagaatctcatcttggcaggagtg
aaaggactgaccatgctggatcacgaacaggtaactccagaagatcccggagctcagttc
ttgattcgtactgggtctgttggccgaaatagggctgaagcctctttggagcgagctcag
aatctcaaccccatggtggatgtgaaggtggacactgaggatatagagaagaaaccagag
tcatttttcactcaattcgatgctgtgtgtctgacttgctgctccagggatgtcatagtt
aaagttgaccagatctgtcacaaaaatagcatcaagttctttacaggagatgtttttggc
taccatggatacacatttgccaatctaggagagcatgagtttgtagaggagaaaactaaa
gttgccaaagttagccaaggagtagaagatgggcccgacaccaagagagcaaaacttgat
tcttctgagacaacgatggtcaaaaagaaggtggtcttctgccctgttaaagaagccctg
gaggtggactggagcagtgagaaagcaaaggctgctctgaagcgcacgacctccgactac
tttctccttcaagtgctcttaaagttccgtacagataaaggaagagatcccagttctgat
acatatgaggaagattctgagttgttgctccagatacgaaatgatgtgcttgactcactg
ggtattagtcctgacctgcttcctgaggactttgtcaggtactgcttctccgagatggcc
ccagtgtgtgcggtggttggagggattttggcacaggaaattgtgaaggccctgtctcag
cgggaccctcctcacaacaacttcttcttcttcgatggcatgaaggggaatgggattgtg
gagtgccttggccccaagtga

DBGET integrated database retrieval system