KEGG   Homo sapiens (human): 10058Help
Entry
10058             CDS       T01001                                 

Gene name
ABCB6, ABC, LAN, MTABC3, PRP, umat
Definition
(RefSeq) ATP binding cassette subfamily B member 6 (Langereis blood group)
  KO
K05661  ATP-binding cassette, subfamily B (MDR/TAP), member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
Disease
H00232  Hereditary stomatocytosis
H01027  Microphthalmia
H02001  Familial pseudohyperkalemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    10058 (ABCB6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10058 (ABCB6)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB6, 7 subgroups
    10058 (ABCB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTABC_N ABC_tran ABC_membrane SMC_N AAA_16 RsgA_GTPase AAA_22 AAA_29 AAA AAA_21 AAA_24 AAA_30 MMR_HSR1 Septin AAA_23 AAA_15
Motif
Other DBs
NCBI-GeneID: 10058
NCBI-ProteinID: NP_005680
OMIM: 605452
HGNC: 47
Ensembl: ENSG00000115657
Vega: OTTHUMG00000133131
Pharos: Q9NP58(Tbio)
UniProt: Q9NP58
Structure
PDB: 

Position
2q35
AA seq 842 aa AA seqDB search
MVTVGNYCEAEGPVGPAWMQDGLSPCFFFTLVPSTRMALGTLALVLALPCRRRERPAGAD
SLSWGAGPRISPYVLQLLLATLQAALPLAGLAGRVGTARGAPLPSYLLLASVLESLAGAC
GLWLLVVERSQARQRLAMGIWIKFRHSPGLLLLWTVAFAAENLALVSWNSPQWWWARADL
GQQVQFSLWVLRYVVSGGLFVLGLWAPGLRPQSYTLQVHEEDQDVERSQVRSAAQQSTWR
DFGRKLRLLSGYLWPRGSPALQLVVLICLGLMGLERALNVLVPIFYRNIVNLLTEKAPWN
SLAWTVTSYVFLKFLQGGGTGSTGFVSNLRTFLWIRVQQFTSRRVELLIFSHLHELSLRW
HLGRRTGEVLRIADRGTSSVTGLLSYLVFNVIPTLADIIIGIIYFSMFFNAWFGLIVFLC
MSLYLTLTIVVTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI
IKYQGLEWKSSASLVLLNQTQNLVIGLGLLAGSLLCAYFVTEQKLQVGDYVLFGTYIIQL
YMPLNWFGTYYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYA
DGRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQDISQVTQA
SLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAAQAAGIHDAIMAFPEGYRTQV
GERGLKLSGGEKQRVAIARTILKAPGIILLDEATSALDTSNERAIQASLAKVCANRTTIV
VAHRLSTVVNADQILVIKDGCIVERGRHEALLSRGGVYADMWQLQQGQEETSEDTKPQTM
ER
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgtgggcaactactgcgaggccgaagggcccgtgggtccggcctggatgcag
gatggcctgagtccctgcttcttcttcacgctcgtgccctcgacgcggatggctctgggg
actctggccttggtgctggctcttccctgcagacgccgggagcggcccgctggtgctgat
tcgctgtcttggggggccggccctcgcatctctccctacgtgctgcagctgcttctggcc
acacttcaggcggcgctgcccctggccggcctggctggccgggtgggcactgcccggggg
gccccactgccaagctatctacttctggcctccgtgctggagagtctggccggcgcctgt
ggcctgtggctgcttgtcgtggagcggagccaggcacggcagcgtctggcaatgggcatc
tggatcaagttcaggcacagccctggtctcctgctcctctggactgtggcgtttgcagct
gagaacttggccctggtgtcttggaacagcccacagtggtggtgggcaagggcagacttg
ggccagcaggttcagtttagcctgtgggtgctgcggtatgtggtctctggagggctgttt
gtcctgggtctctgggcccctggacttcgtccccagtcctatacattgcaggttcatgaa
gaggaccaagatgtggaaaggagccaggttcggtcagcagcccaacagtctacctggcga
gattttggcaggaagctccgcctcctgagtggctacctgtggcctcgagggagtccagct
ctgcagctggtggtgctcatctgcctggggctcatgggtttggaacgggcactcaatgtg
ttggtgcctatattctataggaacattgtgaacttgctgactgagaaggcaccttggaac
tctctggcctggactgttaccagttacgtcttcctcaagttcctccaggggggtggcact
ggcagtacaggcttcgtgagcaacctgcgcaccttcctgtggatccgggtgcagcagttc
acgtctcggcgggtggagctgctcatcttctcccacctgcacgagctctcactgcgctgg
cacctggggcgccgcacaggggaggtgctgcggatcgcggatcggggcacatccagtgtc
acagggctgctcagctacctggtgttcaatgtcatccccacgctggccgacatcatcatt
ggcatcatctacttcagcatgttcttcaacgcctggtttggcctcattgtgttcctgtgc
atgagtctttacctcaccctgaccattgtggtcactgagtggagaaccaagtttcgtcgt
gctatgaacacacaggagaacgctacccgggcacgagcagtggactctctgctaaacttc
gagacggtgaagtattacaacgccgagagttacgaagtggaacgctatcgagaggccatc
atcaaatatcagggtttggagtggaagtcgagcgcttcactggttttactaaatcagacc
cagaacctggtgattgggctcgggctcctcgccggctccctgctttgcgcatactttgtc
actgagcagaagctacaggttggggactatgtgctctttggcacctacattatccagctg
tacatgcccctcaattggtttggcacctactacaggatgatccagaccaacttcattgac
atggagaacatgtttgacttgctgaaagaggagacagaagtgaaggaccttcctggagca
gggccccttcgctttcagaagggccgtattgagtttgagaacgtgcacttcagctatgcc
gatgggcgggagactctgcaggacgtgtctttcactgtgatgcctggacagacacttgcc
ctggtgggcccatctggggcagggaagagcacaattttgcgcctgctgtttcgcttctac
gacatcagctctggctgcatccgaatagatgggcaggacatttcacaggtgacccaggcc
tctctccggtctcacattggagttgtgccccaagacactgtcctctttaatgacaccatc
gccgacaatatccgttacggccgtgtcacagctgggaatgatgaggtggaggctgctgct
caggctgcaggcatccatgatgccattatggctttccctgaagggtacaggacacaggtg
ggcgagcggggactgaagctgagcggcggggagaagcagcgcgtcgccattgcccgcacc
atcctcaaggctccgggcatcattctgctggatgaggcaacgtcagcgctggatacatct
aatgagagggccatccaggcttctctggccaaagtctgtgccaaccgcaccaccatcgta
gtggcacacaggctctcaactgtggtcaatgctgaccagatcctcgtcatcaaggatggc
tgcatcgtggagaggggacgacacgaggctctgttgtcccgaggtggggtgtatgctgac
atgtggcagctgcagcagggacaggaagaaacctctgaagacactaagcctcagaccatg
gaacggtga

DBGET integrated database retrieval system