KEGG   Homo sapiens (human): 10059Help
Entry
10059             CDS       T01001                                 

Gene name
DNM1L, DLP1, DRP1, DVLP, DYMPLE, EMPF, EMPF1, HDYNIV, OPA5
Definition
(RefSeq) dynamin 1 like
  KO
K17065  dynamin 1-like protein [EC:3.6.5.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
Disease
H01020  Optic atrophy
H01900  Encephalopathy due to defective mitochondrial and peroxisomal fission
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    10059 (DNM1L)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    10059 (DNM1L)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    10059 (DNM1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10059 (DNM1L)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10059 (DNM1L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10059 (DNM1L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     10059 (DNM1L)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    10059 (DNM1L)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    10059 (DNM1L)
   RhoA-dependent endocytosis
    10059 (DNM1L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    10059 (DNM1L)
   Retention of mitochondria
    10059 (DNM1L)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10059 (DNM1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_16 FtsK_SpoIIIE AAA_28
Motif
Other DBs
NCBI-GeneID: 10059
NCBI-ProteinID: NP_036192
OMIM: 603850
HGNC: 2973
Ensembl: ENSG00000087470
Vega: OTTHUMG00000169451
Pharos: O00429(Tbio)
UniProt: O00429 B4DYR6
Structure
PDB: 

Position
12p11.21
AA seq 736 aa AA seqDB search
MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTR
RPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISG
NNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSI
ILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG
IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC
LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSEL
CGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN
EMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSAL
APASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEE
LLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRK
NIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKAL
QGASQIIAEIRETHLW
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctaattcctgtcataaacaagctccaggacgtcttcaacacggtgggcgcc
gacatcatccagctgcctcaaatcgtcgtagtgggaacgcagagcagcggaaagagctca
gtgctagaaagcctggtggggagggacctgcttcccagaggtactggaattgtcacccgg
agacctctcattctgcaactggtccatgtttcacaagaagataaacggaaaacaacagga
gaagaaaatggggtggaagcagaagaatggggtaaatttcttcacaccaaaaataagctt
tacacggattttgatgaaattcgacaagaaattgaaaatgaaacagaaagaatttcagga
aataataagggagtaagccctgaaccaattcatcttaagattttttcacccaacgttgtc
aatttgacacttgtggatttgccaggaatgaccaaggtgcctgtaggtgatcaacctaag
gatattgagcttcaaatcagagagctcattcttcggttcatcagtaatcctaattccatt
atcctcgctgtcactgctgctaatacagatatggcaacatcagaggcacttaaaatttca
agagaggtagatccagatggtcgcagaaccctagctgtaatcactaaacttgatctcatg
gatgcgggtactgatgccatggatgtattgatgggaagggttattccagtcaaacttgga
ataattggagtagttaacaggagccagctagatattaacaacaagaagagtgtaactgat
tcaatccgtgatgagtatgcttttcttcaaaagaaatatccatctctggccaatagaaat
ggaacaaagtatcttgctaggactctaaacaggttactgatgcatcacatcagagattgt
ttaccagagttgaaaacaagaataaatgttctagctgctcagtatcagtctcttctaaat
agctacggtgaacccgtggatgataaaagtgctactttactccaacttattaccaaattt
gccacagaatattgtaacactattgaaggaactgcaaaatatattgaaacttcggagcta
tgcggtggtgctagaatttgttatattttccatgagacttttgggcgaaccttagaatct
gttgatccacttggtggccttaacactattgacattttgactgccattagaaatgctact
ggtcctcgtcctgctttatttgtgcctgaggtttcatttgagttactggtgaagcggcaa
atcaaacgtctagaagagcccagcctccgctgtgtggaactggttcatgaggaaatgcaa
aggatcattcagcactgtagcaattacagtacacaggaattgttacgatttcctaaactt
catgatgccatagttgaagtggtgacttgtcttcttcgtaaaaggttgcctgttacaaat
gaaatggtccataacttagtggcaattgaactggcttatatcaacacaaaacatccagac
tttgctgatgcttgtgggctaatgaacaataatatagaggaacaaaggagaaacaggcta
gccagagaattaccttcagctgtatcacgagacaagtcttctaaagttccaagtgctttg
gcacctgcctcccaggagccctcccccgctgcttctgctgaggctgatggcaagttaatt
caggacagcagaagagaaactaaaaatgttgcatctggaggtggtggggttggagatggt
gttcaagaaccaaccacaggcaactggagaggaatgctgaaaacttcaaaagctgaagag
ttattagcagaagaaaaatcaaaacccattccaattatgccagccagtccacaaaaaggt
catgccgtgaacctgctagatgtgccagttcctgttgcacgaaaactatctgctcgggaa
cagcgagattgtgaggttattgaacgactcattaaatcatattttctcattgtcagaaag
aatattcaagacagtgtgccaaaggcagtaatgcattttttggttaatcatgtgaaagac
actcttcagagtgagctagtaggccagctgtataaatcatccttattggatgatcttctg
acagaatctgaggacatggcacagcgcaggaaagaagcagctgatatgctaaaggcatta
caaggagccagtcaaattattgctgaaatccgggagactcatctttggtga

DBGET integrated database retrieval system