KEGG   Homo sapiens (human): 10060Help
Entry
10060             CDS       T01001                                 

Gene name
ABCC9, ABC37, ATFB12, CANTU, CMD1O, SUR2
Definition
(RefSeq) ATP binding cassette subfamily C member 9
  KO
K05033  ATP-binding cassette subfamily C (CFTR/MRP) member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
Disease
H00294  Dilated cardiomyopathy
H00731  Atrial fibrillation
Drug target
Levcromakalim: D02385
Naminidil: D05114
Nicorandil: D01810
Pinacidil: D05482
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    10060 (ABCC9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10060 (ABCC9)
   04147 Exosome [BR:hsa04147]
    10060 (ABCC9)
Transporters [BR:hsa02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC8, 9 subgroups
    10060 (ABCC9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10060 (ABCC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 MMR_HSR1 AAA_25 Zeta_toxin AAA_16
Motif
Other DBs
NCBI-GeneID: 10060
NCBI-ProteinID: NP_005682
OMIM: 601439
HGNC: 60
Ensembl: ENSG00000069431
Vega: OTTHUMG00000169094
Pharos: O60706(Tclin)
UniProt: O60706 A0A024RAV7
Position
12p12.1
AA seq 1549 aa AA seqDB search
MSLSFCGNNISSYNINDGVLQNSCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHH
NTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSRRESRHLHLFMPAVMGFVATTTSIV
YYHNIETSNFPKLLLALFLYWVMAFITKTIKLVKYCQSGLDISNLRFCITGMMVILNGLL
MAVEINVIRVRRYVFFMNPQKVKPPEDLQDLGVRFLQPFVNLLSKATYWWMNTLIISAHK
KPIDLKAIGKLPIAMRAVTNYVCLKDAYEEQKKKVADHPNRTPSIWLAMYRAFGRPILLS
STFRYLADLLGFAGPLCISGIVQRVNETQNGTNNTTGISETLSSKEFLENAYVLAVLLFL
ALILQRTFLQASYYVTIETGINLRGALLAMIYNKILRLSTSNLSMGEMTLGQINNLVAIE
TNQLMWFLFLCPNLWAMPVQIIMGVILLYNLLGSSALVGAAVIVLLAPIQYFIATKLAEA
QKSTLDYSTERLKKTNEILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLSI
FMNAAIPIAAVLATFVTHAYASGNNLKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAII
SVQKLNEFLLSDEIGDDSWRTGESSLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTR
RLRPAETEDIAIKVTNGYFSWGSGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILG
EMQTLEGKVHWSNVNESEPSFEATRSRNRYSVAYAAQKPWLLNATVEENITFGSPFNKQR
YKAVTDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFS
ALDIHLSDHLMQEGILKFLQDDKRTLVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQ
TKDVELYEHWKTLMNRQDQELEKDMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEE
EDEDDNMSTVMRLRTKMPWKTCWRYLTSGGFFLLILMIFSKLLKHSVIVAIDYWLATWTS
EYSINNTGKADQTYYVAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGP
IRFFDTTPLGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLVALL
PLGVAFYFIQKYFRVASKDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLE
LTDTNNIAYLFLSAANRWLEVRTDYLGACIVLTASIASISGSSNSGLVGLGLLYALTITN
YLNWVVRNLADLEVQMGAVKKVNSFLTMESENYEGTMDPSQVPEHWPQEGEIKIHDLCVR
YENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKL
PLHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKSLPGGLDA
VVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTV
VTIAHRVSSIMDAGLVLVFSEGILVECDTVPNLLAHKNGLFSTLVMTNK
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atgagcctttcattttgtggtaacaacatttcttcatataatatcaacgatggtgtacta
caaaattcctgctttgtggatgccctcaacctggtccctcatgtctttctgttgtttatc
acttttccaatattgtttattgggtgggggagccaaagctcaaaagtacaaattcaccac
aacacatggcttcattttccgggacataacctgagatggattcttacattcgctctcctg
tttgtgcatgtctgtgaaatagcagaaggcattgtttcagactcgcggcgggaatcaagg
cacctccacctctttatgccagccgtgatgggattcgttgccactacaacatcgatagtg
tattatcataatatcgaaacatcaaattttcctaaattacttttagccctgttcctgtat
tgggtaatggcctttattacaaaaacaataaaattggttaagtactgtcagtctggcttg
gacatatcaaacctgcgtttctgcatcacaggcatgatggtcatcttgaatgggctcttg
atggctgtggagatcaatgtcattcgagtcaggagatatgtatttttcatgaatcctcag
aaagtaaagcctcctgaagacctccaggatctgggagtgagatttcttcaaccatttgtg
aatttgctgtcaaaagcaacatactggtggatgaacacacttattatatctgctcacaaa
aagcctattgatctgaaggcaattggaaaattgccaatagcaatgagagcagtaacaaat
tatgtttgcctgaaagatgcatatgaagaacaaaagaaaaaagttgcagatcatccaaat
cggactccatctatatggcttgcaatgtacagagcttttgggcgaccaattctacttagt
agcacattccgctatctggctgatttactgggttttgctggacctctttgtatttctgga
atagttcagcgtgtgaatgaaacccagaatgggacaaataacacaactggaatttcagaa
accctctcatcaaaggaatttcttgaaaacgcttacgttctagcagttcttctcttcttg
gctcttattctgcaaaggacatttttgcaggcttcctactatgtaaccatagagactggc
attaacctccgtggagctctgctggccatgatttataataaaatccttaggctctctacg
tctaacttatccatgggggagatgactctggggcagatcaacaacttagtcgccattgaa
actaatcaactcatgtggtttttgttcctgtgtcccaatctatgggctatgcctgttcag
atcataatgggcgtgattctgctctataatttacttggatcaagtgcattggtcggtgca
gctgtcattgtgctccttgcgccaattcagtactttattgctacaaagttggcagaggct
cagaaaagtacacttgattattccactgagagactcaagaaaacaaatgaaatattgaaa
ggcatcaaacttctaaaattgtatgcctgggaacacattttctgcaaaagtgtggaggaa
acaagaatgaaagaactatctagtctcaaaacctttgcactatatacatcactctccatc
ttcatgaatgcagcaattcccatagcagctgttcttgctacatttgtgacccatgcgtat
gccagtggaaacaatctgaaacctgcagaggcctttgcttcactgtctctcttccatatc
ctggtcacaccactgttcctgctctccacggtggtcagatttgcagtcaaagccatcata
agtgttcaaaagctgaatgagtttctcttgagtgatgagattggtgacgacagttggcga
actggtgaaagttcgcttccttttgagtcctgtaagaagcacactggagttcagccaaaa
actataaacaggaaacagcctggaagatatcacctggacagctatgagcaatcaacacgg
cgtctacgtcccgcagaaacagaggacattgcaataaaggtcacaaatggatacttttca
tggggcagtggtttagctacattatccaatatagatattcgaattccaacaggtcagtta
accatgattgtgggccaagtaggatgtgggaagtcctctcttctccttgccatcctcggt
gagatgcagacattggaaggaaaagttcactggagcaatgtaaatgaatctgagccttct
tttgaagcaaccagaagtaggaacaggtactctgtggcatatgcagctcaaaagccttgg
ctattaaatgctacagtagaagaaaatattacttttggaagtccttttaacaaacagagg
tacaaagctgtcacagatgcctgttctcttcagccagatattgacttattaccatttgga
gatcaaactgaaattggagagaggggcatcaacctgagtgggggacagaggcagagaatc
tgtgtggcacgagcgctgtatcaaaacaccaacattgtctttttggatgatccattctca
gccctggacattcacttgagtgatcatttaatgcaggaggggattttgaaattcctgcaa
gatgacaaaaggacactcgttcttgtgactcacaaattacagtatctgacgcatgctgac
tggatcatagccatgaaagatggaagtgtcctaagagaaggaactttgaaggacattcaa
accaaagatgttgagctttatgaacactggaaaacacttatgaatcggcaagatcaagaa
ttagaaaaggatatggaagctgaccaaactactttagagaggaaaactctccgacgggcc
atgtattcaagagaagccaaagcccagatggaggacgaagacgaagaggaagaagaggag
gaagatgaggatgataacatgtccactgtaatgaggctcaggactaaaatgccatggaaa
acctgctggcgctacctgacatctggaggattcttcctgctcatcctgatgattttctct
aagcttttgaagcattcggtcattgtagctatagactattggctggccacatggacatcg
gagtacagtataaacaatactggaaaagctgatcagacctactatgtggctggctttagc
atactctgtggagcaggcattttcctttgccttgttacatccctcactgtagaatggatg
ggtctcacagctgccaaaaatcttcaccacaaccttctcaataagataatccttggacca
ataaggttttttgataccacacccctgggactgattctcaatcgcttttcagctgatact
aatatcattgatcagcacatccctccaaccttggaatctctaactcgctcaacactgctc
tgcctgtctgccattgggatgatttcttatgctactcctgtgttcctggttgctctcctg
ccccttggtgttgccttttattttatccagaaatactttcgggttgcctctaaggacctc
caggaacttgacgatagtacccagctccctctgctctgtcacttctcagaaacagcagaa
ggactcaccaccattcgggcctttaggcatgaaaccagatttaaacaacgtatgctggaa
ctgacggatacaaacaacattgcctacttatttctctcagctgccaacagatggctggag
gtcaggacggattatctgggagcttgcattgtcctcactgcatctatagcatccattagt
gggtcttcgaattctggattggtaggcttgggtcttctgtatgcacttacgataaccaat
tatttgaattgggttgtgaggaacttggctgacctggaggtccagatgggtgcagtgaag
aaggtgaacagtttcctgactatggagtcagagaactatgaaggcacaatggatccttct
caagttccagaacattggccacaagaaggggagatcaagatacatgatctgtgtgtcaga
tatgaaaataatctgaaacctgttcttaagcacgtcaaggcttacatcaaacctggacaa
aaggtgggcatatgtggtcgcactggcagtgggaaatcatcgttatctctggctttcttc
agaatggttgatatatttgatggaaaaattgtcattgatgggatagacatttccaaatta
ccactgcacacactacgttctagactttcaatcattctgcaggatccaatactattcagt
ggttccattagatttaatttagatccagagtgcaaatgcacagatgacagactctgggaa
gccttagaaattgctcagctgaagaatatggtcaaatctctacctggaggtctagatgcg
gttgtcactgaaggtggggagaattttagcgttggacagagacagctattttgccttgcc
agggcctttgtccgcaaaagcagcattcttattatggatgaggcaacagcttccattgac
atggccacagagaatattttgcaaaaagtagtaatgacagcctttgcagaccggaccgtg
gtgacaatagctcaccgtgtctcttctattatggatgcaggccttgttttagtcttttct
gagggtattttagtggagtgtgatactgtcccaaatttgctcgcccacaagaatggcctc
ttttccactttggtgatgaccaacaagtag

DBGET integrated database retrieval system