KEGG   Homo sapiens (human): 10063Help
Entry
10063             CDS       T01001                                 

Gene name
COX17
Definition
(RefSeq) cytochrome c oxidase copper chaperone COX17
  KO
K02260  cytochrome c oxidase assembly protein subunit 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
Module
hsa_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    10063 (COX17)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    10063 (COX17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10063 (COX17)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    10063 (COX17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX17
Motif
Other DBs
NCBI-GeneID: 10063
NCBI-ProteinID: NP_005685
OMIM: 604813
HGNC: 2264
Ensembl: ENSG00000138495
Vega: OTTHUMG00000159433
Pharos: Q14061(Tbio)
UniProt: Q14061
Structure
PDB: 

Position
3q13.33
AA seq 63 aa AA seqDB search
MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG
FKI
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtctggttgactcaaaccctgccccgcctgagtctcaggagaagaagccgctg
aagccctgctgcgcttgcccggagaccaagaaggcgcgcgatgcgtgtatcatcgagaaa
ggagaagaacactgtggacatctaattgaggcccacaaggaatgcatgagagccctagga
tttaaaatatga

DBGET integrated database retrieval system