KEGG   Homo sapiens (human): 100652824
Entry
100652824         CDS       T01001                                 

Definition
(RefSeq) KIAA2012
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4670
Other DBs
NCBI-GeneID: 100652824
NCBI-ProteinID: NP_001264301
HGNC: 51250
Ensembl: ENSG00000182329
Vega: OTTHUMG00000154580
UniProt: H7C5G6
Position
2q33.1
AA seq 1181 aa
MFTLSLLSRGHGKLGQDKQKLEVYFEPEDYLNWRSPEDYVPVSKPQDKNNASQHSWSLFL
PKTFSTRKGALILYSEGFAISAWTPKERRKGPYCPRGPWRKLDLELHTLQDLKEAILAYG
RQQGEQDRAWQPYLHFRSQLESQAQRQIQPGHSAKRYLRGLLRTWPPDAMYRLWCAGYIK
DSVLLQDSQLNVPKKLRPQQDLSGVPPKYHLLPVFPSFWIQQGKSFEQRQQGLDEGEAGA
AGHVDQGPLAKNHGSQGTRLPPRRKQPWQEDETQAEDTSIENHLCLYASKESYNEKTQQT
SRKAFGHGRIDHSWLPSDKSHITFCGGAFPNRKADLSDKQRNVKLHKARSSHLLQVLPAE
RSLFPPVASATGSRIITPGEVKKKKAPKALKLPPISEEPPRVLEPLKSQFKANEPPTELF
ILPVEIHYHTKQPPKEKAHRRGAPHPESEPESSEESTPVWRPPLKHASLETPWELTVHLP
VDASRDTLSPQDDDAPPHDVAPPLDLLPPIKGKKSPESQKGVDSPRTSDHNSPPSLPNMR
VPRRALPAAQEDSSDPTLGHFLLGPDGEKVCLSLPGHTQTEALPSGKAYESVNSNISHEE
EGPSSQHFLKANTEPRANLHMNLYETSPLTQTTEKQGAQQSLEAAAQKTGEPQSCINKAL
ICSNRKEFYTRKLHIDMTPFLKESGNALDYQEEAGRPLRETHHNDQDPEPRSMTLDSPRA
SRTEHIQTPEADIVQKVGRDYDVHHLHRGLLGYGPESPERLSAVYTSLLPREREGKAEPR
LFSQETSANISHERDLINEAKRKEKPKKDKTKGPKSEREGKVYGQAEAAIGKSKDSKAKK
KLEKKTRPQRKRTQKERNLEIAAELSGPDVSYEETEDTSNRGSFASDSFVEDPWLSPKYD
AQESQVSLDGRSSPSQIATVTGNMESKEERRCEDPSKALLTKREQEKASWDRLRAERAEM
RWLEVEKKRREQEEQRQLQQEQLERAKKMEEELELEQQRRTEEIRLRKQRLQEEQQRQEE
EERKQQLRLKAAQERARQQQEEFRRKLRELQRKKQQEEAERAEAEKQRQEELEMQLEEEQ
KHLMEMAEEERLEYQRRKQEAEEKARLEAEERRQKEEEAARLALEEATKQAQEQARQKAA
LEKHFHFYQELHKEASGLQWTQNISRPWVYSYFQFLQIPRP
NT seq 3546 nt   +upstreamnt  +downstreamnt
atgttcacgctctccctcctgagccggggccacgggaagctgggccaggacaaacagaag
ttagaagtctactttgaaccagaggattacttgaactggaggtccccagaagactatgtt
cctgtcagcaaacctcaagataagaacaatgccagtcagcactcctggagcctctttctc
cctaaaactttcagtactagaaagggtgccctgatcctgtactcagaaggttttgccatt
tcggcatggacacccaaagagaggagaaaaggcccctactgccccagaggtccctggagg
aagctggatcttgaactgcacacacttcaagacctcaaagaagccatcctggcatatgga
aggcagcagggagagcaggacagagcctggcaaccatacctccacttccgaagccagctg
gagagccaggcccaacggcagatccagccagggcattcagccaagagatacctccgaggc
ctcctgcggacttggcccccagacgccatgtataggctctggtgcgcaggatacatcaag
gattctgtgctactccaggacagtcaacttaatgtaccaaagaagctcaggccacaacaa
gatctttcaggtgtacccccaaaataccatctcctgcctgtcttcccttcattttggatt
caacaaggaaaatcttttgaacaacgtcaacagggcctggatgaaggggaagctggagct
gctggacacgtggaccagggccctctagccaagaaccatggcagtcaggggactcgcttg
ccaccacgcaggaagcagccctggcaggaagatgaaacgcaggcagaggacacgtcaata
gagaatcacctttgtttatatgcttcaaaggagagctacaatgaaaagacacagcaaacc
tccaggaaggcctttgggcatggccgcatcgatcactcttggctcccaagtgacaaatcc
cacattacattctgtggaggcgccttccctaataggaaggcagatctcagcgataaacaa
aggaacgtgaaactccacaaggccagaagcagccacttgttacaggtgcttcctgctgaa
agaagcctcttccctcctgtagcatctgccactggctccagaataatcacccctggggaa
gtgaagaagaaaaaggcaccaaaggctttgaaattacctcctatctcagaagaaccaccc
agagtcttggagcccctgaagagccaatttaaagccaatgagcccccaacagagctcttc
atcttaccggtggagattcattaccacaccaaacaacccccaaaagagaaagcccacaga
agaggtgctccacaccctgagtcagaaccagaaagcagcgaagaatccacacctgtgtgg
agacctcccctgaagcatgcgtccttagaaacaccatgggagttaacagtgcatctccca
gtggacgcgagcagggacacactctcacctcaagatgatgatgccccacctcacgatgtg
gccccaccattggatcttctacccccgattaaaggaaaaaaaagtcctgagagccagaag
ggcgtggacagccctaggacatcagaccacaacagccccccaagtctcccgaacatgaga
gtgcccaggagggcactgccagcagctcaagaagattccagcgaccctacactgggacac
ttcttgctgggtccagatggagaaaaagtctgcctgtccctcccagggcatacccaaacc
gaggcgcttccatcgggtaaagcctatgaatctgtcaattcaaatatcagccatgaagag
gaagggcctagtagtcagcatttcctaaaagcaaacactgaacctagagccaatcttcac
atgaacctttatgaaacctcaccgttgacccaaacaacagagaagcagggagcccagcag
tccttggaggcagcagctcagaagacaggagagcctcaaagttgtataaataaagcgctg
atatgttcaaacagaaaagaattttacacgcgcaagctgcacatcgacatgacgccgttc
ctgaaggaaagtggaaatgcactggactatcaggaagaagcagggagacccctcagagaa
actcaccacaacgaccaagacccagagccaaggagtatgacccttgactctcccagggct
tcccggactgagcacatccagaccccagaagcagatattgtgcaaaaagtgggcagagat
tatgatgtacaccacctacacagaggacttctgggatacgggcctgagtcacccgagagg
ttgagtgctgtgtatacatctcttcttccaagagaaagagaagggaaggctgaaccaaga
ctgtttagccaggagacatcagccaacatcagtcatgagagggatttgattaacgaggcc
aagagaaaggaaaaacccaagaaagacaaaaccaaaggacccaaaagcgagagagaagga
aaggtctacgggcaagcagaggctgccattggaaagtcaaaggactcaaaggctaaaaaa
aaattagaaaaaaaaacaagaccccaaaggaaaaggacacagaaggaaagaaatctggag
atagcggcagagctgagcgggcctgatgtcagctatgaggaaacagaagacacctcaaat
agaggttcctttgcctcagactcctttgtagaggacccttggctttctcccaaatatgat
gcccaggaaagccaagtttctctagatggaagatcatcaccctctcagattgcaactgtc
actggcaacatggaatctaaagaagagagaagatgtgaggacccttccaaggccctcctc
actaagagggagcaggagaaggcttcctgggacaggcttcgagcagaaagagccgagatg
aggtggctggaggtggagaagaagagaagggagcaggaagagcaaaggcagctccagcag
gagcagctggagagagcaaaaaagatggaggaggagctggagctggagcagcagagacgt
acagaagagatccgcttgaggaaacagagactccaagaagaacagcagcggcaggaggag
gaggagagaaagcagcagctccggttgaaagcagcccaggagagagcccggcaacagcaa
gaggagtttcggaggaaactgcgagaactacagagaaaaaagcagcaggaggaagccgag
agggccgaggcagagaagcaaaggcaagaggaattggaaatgcagttagaagaagaacaa
aaacacctgatggaaatggctgaagaggaacgactggagtaccagcggcggaaacaggaa
gcagaagagaaggctcggctggaggcagaggagaggaggcaaaaagaagaggaagcagca
agactggctctggaagaagccacgaaacaagcccaggaacaagccaggcaaaaagctgct
ttggagaaacattttcatttctatcaagaactccataaggaagccagtggcctgcagtgg
acacagaacatttccagaccatgggtttactcttatttccagttcctacaaatacccagg
ccttaa

DBGET integrated database retrieval system