KEGG   Homo sapiens (human): 10067Help
Entry
10067             CDS       T01001                                 

Gene name
SCAMP3, C1orf3
Definition
(RefSeq) secretory carrier membrane protein 3
  KO
K19995  secretory carrier-associated membrane protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10067 (SCAMP3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Others
   Others
    10067 (SCAMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCAMP Phage_holin_3_6
Motif
Other DBs
NCBI-GeneID: 10067
NCBI-ProteinID: NP_005689
OMIM: 606913
HGNC: 10565
Ensembl: ENSG00000116521
Vega: OTTHUMG00000035874
Pharos: O14828(Tbio)
UniProt: O14828
Position
1q22
AA seq 347 aa AA seqDB search
MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAP
LPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRREREL
QHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLL
NFLACLASFCVETNNGAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIF
FVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRI
HSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctcagagcagagacggcggaaacccgttcgccgagcccagcgagcttgacaacccc
tttcaggacccagctgtgatccagcaccgacccagccggcagtatgccacgcttgacgtc
tacaacccttttgagacccgggagccaccaccagcctatgagcctccagcccctgcccca
ttgcctccaccctcagctccctccttgcagccctcgagaaagctcagccccacagaacct
aagaactatggctcatacagcactcaggcctcagctgcagcagccacagctgagctgctg
aagaaacaggaggagctcaaccggaaggcagaggagttggaccgaagggagcgagagctg
cagcatgctgccctggggggcacagctactcgacagaacaattggccccctctaccttct
ttttgtccagttcagccctgctttttccaggacatctccatggagatcccccaagaattt
cagaagactgtatccaccatgtactacctctggatgtgcagcacgctggctcttctcctg
aacttcctcgcctgcctggccagcttctgtgtggaaaccaacaatggcgcaggctttggg
ctttctatcctctgggtcctccttttcactccctgctcctttgtctgctggtaccgcccc
atgtataaggctttccggagtgacagttcattcaatttcttcgttttcttcttcattttc
ttcgtccaggatgtgctctttgtcctccaggccattggtatcccaggttggggattcagt
ggctggatctctgctctggtggtgccgaagggcaacacagcagtatccgtgctcatgctg
ctggtcgccctgctcttcactggcattgctgtgctaggaattgtcatgctgaaacggatc
cactccttataccgccgcacaggtgccagctttcagaaggcccagcaagaatttgctgct
ggtgtcttctccaaccctgcggtgcgaaccgcagctgccaatgcagccgctggggctgct
gaaaatgccttccgggccccgtga

DBGET integrated database retrieval system