KEGG   Homo sapiens (human): 10071Help
Entry
10071             CDS       T01001                                 

Gene name
MUC12, MUC-11, MUC-12, MUC11
Definition
(RefSeq) mucin 12, cell surface associated
  KO
K22018  mucin-12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10071 (MUC12)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Membrane bound mucins
    10071 (MUC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SEA
Motif
Other DBs
NCBI-GeneID: 10071
NCBI-ProteinID: NP_001157934
OMIM: 604609
HGNC: 7510
Ensembl: ENSG00000205277
Vega: OTTHUMG00000157042
Pharos: Q9UKN1(Tbio)
UniProt: Q9UKN1
Position
7q22.1
AA seq 5335 aa AA seqDB search
MLVIWILTLALRLCASVTTVTPGSTVNTSIGGNTTSASTPSSSDPFTTFSDYGVSVTFIT
GSTATKHFLDSSTNSGHSEESTVSHSGPGATGTTLFPSHSATSVFVGEPKTSPITSASME
TTALPGSTTTAGLSEKSTTFYSSPRSPDRTLSPARTTSSGVSEKSTTSHSRPGPTHTIAF
PDSTTMPGVSQESTASHSIPGSTDTTLSPGTTTPSSLGPESTTFHSSPGYTKTTRLPDNT
TTSGLLEASTPVHSSTGSPHTTLSPSSSTTHEGEPTTFQSWPSSKDTSPAPSGTTSAFVK
LSTTYHSSPSSTPTTHFSASSTTLGHSEESTPVHSSPVATATTPPPARSATSGHVEESTA
YHRSPGSTQTMHFPESSTTSGHSEESATFHGSTTHTKSSTPSTTAALAHTSYHSSLGSTE
TTHFRDSSTISGRSEESKASHSSPDAMATTVLPAGSTPSVLVGDSTPSPISSGSMETTAL
PGSTTKPGLSEKSTTFYSSPRSPDTTHLPASMTSSGVSEESTTSHSRPGSTHTTAFPGST
TMPGLSQESTASHSSPGPTDTTLSPGSTTASSLGPEYTTFHSRPGSTETTLLPDNTTASG
LLEASMPVHSSTRSPHTTLSPAGSTTRQGESTTFHSWPSSKDTRPAPPTTTSAFVEPSTT
SHGSPSSIPTTHISARSTTSGLVEESTTYHSSPGSTQTMHFPESDTTSGRGEESTTSHSS
TTHTISSAPSTTSALVEEPTSYHSSPGSTATTHFPDSSTTSGRSEESTASHSSQDATGTI
VLPARSTTSVLLGESTTSPISSGSMETTALPGSTTTPGLSERSTTFHSSPRSPATTLSPA
STTSSGVSEESTTSRSRPGSTHTTAFPDSTTTPGLSRHSTTSHSSPGSTDTTLLPASTTT
SGPSQESTTSHSSSGSTDTALSPGSTTALSFGQESTTFHSNPGSTHTTLFPDSTTSSGIV
EASTRVHSSTGSPRTTLSPASSTSPGLQGESTAFQTHPASTHTTPSPPSTATAPVEESTT
YHRSPGSTPTTHFPASSTTSGHSEKSTIFHSSPDASGTTPSSAHSTTSGRGESTTSRISP
GSTEITTLPGSTTTPGLSEASTTFYSSPRSPTTTLSPASMTSLGVGEESTTSRSQPGSTH
STVSPASTTTPGLSEESTTVYSSSRGSTETTVFPHSTTTSVHGEEPTTFHSRPASTHTTL
FTEDSTTSGLTEESTAFPGSPASTQTGLPATLTTADLGEESTTFPSSSGSTGTKLSPARS
TTSGLVGESTPSRLSPSSTETTTLPGSPTTPSLSEKSTTFYTSPRSPDATLSPATTTSSG
VSEESSTSHSQPGSTHTTAFPDSTTTSDLSQEPTTSHSSQGSTEATLSPGSTTASSLGQQ
STTFHSSPGDTETTLLPDDTITSGLVEASTPTHSSTGSLHTTLTPASSTSAGLQEESTTF
QSWPSSSDTTPSPPGTTAAPVEVSTTYHSRPSSTPTTHFSASSTTLGRSEESTTVHSSPG
ATGTALFPTRSATSVLVGEPTTSPISSGSTETTALPGSTTTAGLSEKSTTFYSSPRSPDT
TLSPASTTSSGVSEESTTSHSRPGSTHTTAFPGSTTMPGVSQESTASHSSPGSTDTTLSP
GSTTASSLGPESTTFHSSPGSTETTLLPDNTTASGLLEASTPVHSSTGSPHTTLSPAGST
TRQGESTTFQSWPSSKDTMPAPPTTTSAFVELSTTSHGSPSSTPTTHFSASSTTLGRSEE
STTVHSSPVATATTPSPARSTTSGLVEESTAYHSSPGSTQTMHFPESSTASGRSEESRTS
HSSTTHTISSPPSTTSALVEEPTSYHSSPGSTATTHFPDSSTTSGRSEESTASHSSQDAT
GTIVLPARSTTSVLLGESTTSPISSGSMETTALPGSTTTPGLSEKSTTFHSSPRSPATTL
SPASTTSSGVSEESTTSHSRPGSTHTTAFPDSTTTPGLSRHSTTSHSSPGSTDTTLLPAS
TTTSGPSQESTTSHSSPGSTDTALSPGSTTALSFGQESTTFHSSPGSTHTTLFPDSTTSS
GIVEASTRVHSSTGSPRTTLSPASSTSPGLQGESTAFQTHPASTHTTPSPPSTATAPVEE
STTYHRSPGSTPTTHFPASSTTSGHSEKSTIFHSSPDASGTTPSSAHSTTSGRGESTTSR
ISPGSTEITTLPGSTTTPGLSEASTTFYSSPRSPTTTLSPASMTSLGVGEESTTSRSQPG
STHSTVSPASTTTPGLSEESTTVYSSSPGSTETTVFPRTPTTSVRGEEPTTFHSRPASTH
TTLFTEDSTTSGLTEESTAFPGSPASTQTGLPATLTTADLGEESTTFPSSSGSTGTTLSP
ARSTTSGLVGESTPSRLSPSSTETTTLPGSPTTPSLSEKSTTFYTSPRSPDATLSPATTT
SSGVSEESSTSHSQPGSTHTTAFPDSTTTPGLSRHSTTSHSSPGSTDTTLLPASTTTSGP
SQESTTSHSSPGSTDTALSPGSTTALSFGQESTTFHSSPGSTHTTLFPDSTTSSGIVEAS
TRVHSSTGSPRTTLSPASSTSPGLQGESTTFQTHPASTHTTPSPPSTATAPVEESTTYHR
SPGSTPTTHFPASSTTSGHSEKSTIFHSSPDASGTTPSSAHSTTSGRGESTTSRISPGST
EITTLPGSTTTPGLSEASTTFYSSPRSPTTTLSPASMTSLGVGEESTTSRSQPGSTHSTV
SPASTTTPGLSEESTTVYSSSPGSTETTVFPRSTTTSVRGEEPTTFHSRPASTHTTLFTE
DSTTSGLTEESTAFPGSPASTQTGLPATLTTADLGEESTTFPSSSGSTGTTLSPARSTTS
GLVGESTPSRLSPSSTETTTLPGSPTTPSLSEKSTTFYTSPRSPDATLSPATTTSSGVSE
ESSTSHSQPGSTHTTAFPDSTTTSGLSQEPTASHSSQGSTEATLSPGSTTASSLGQQSTT
FHSSPGDTETTLLPDDTITSGLVEASTPTHSSTGSLHTTLTPASSTSAGLQEESTTFQSW
PSSSDTTPSPPGTTAAPVEVSTTYHSRPSSTPTTHFSASSTTLGRSEESTTVHSSPGATG
TALFPTRSATSVLVGEPTTSPISSGSTETTALPGSTTTAGLSEKSTTFYSSPRSPDTTLS
PASTTSSGVSEESTTSHSRPGSTHTTAFPGSTTMPGVSQESTASHSSPGSTDTTLSPGST
TASSLGPESTTFHSGPGSTETTLLPDNTTASGLLEASTPVHSSTGSPHTTLSPAGSTTRQ
GESTTFQSWPNSKDTTPAPPTTTSAFVELSTTSHGSPSSTPTTHFSASSTTLGRSEESTT
VHSSPVATATTPSPARSTTSGLVEESTTYHSSPGSTQTMHFPESDTTSGRGEESTTSHSS
TTHTISSAPSTTSALVEEPTSYHSSPGSTATTHFPDSSTTSGRSEESTASHSSQDATGTI
VLPARSTTSVLLGESTTSPISSGSMETTALPGSTTTPGLSEKSTTFHSSPRSPATTLSPA
STTSSGVSEESTTSHSRPGSTHTTAFPDSTTTPGLSRHSTTSHSSPGSTDTTLLPASTTT
SGSSQESTTSHSSSGSTDTALSPGSTTALSFGQESTTFHSSPGSTHTTLFPDSTTSSGIV
EASTRVHSSTGSPRTTLSPASSTSPGLQGESTAFQTHPASTHTTPSPPSTATAPVEESTT
YHRSPGSTPTTHFPASSTTSGHSEKSTIFHSSPDASGTTPSSAHSTTSGRGESTTSRISP
GSTEITTLPGSTTTPGLSEASTTFYSSPRSPTTTLSPASMTSLGVGEESTTSRSQPGSTH
STVSPASTTTPGLSEESTTVYSSSPGSTETTVFPRSTTTSVRREEPTTFHSRPASTHTTL
FTEDSTTSGLTEESTAFPGSPASTQTGLPATLTTADLGEESTTFPSSSGSTGTKLSPARS
TTSGLVGESTPSRLSPSSTETTTLPGSPTTPSLSEKSTTFYTSPRSPDATLSPATTTSSG
VSEESSTSHSQPGSTHTTAFPDSTTTSGLSQEPTTSHSSQGSTEATLSPGSTTASSLGQQ
STTFHSSPGDTETTLLPDDTITSGLVEASTPTHSSTGSLHTTLTPASSTSTGLQEESTTF
QSWPSSSDTTPSPPSTTAVPVEVSTTYHSRPSSTPTTHFSASSTTLGRSEESTTVHSSPG
ATGTALFPTRSATSVLVGEPTTSPISSGSTETTALPGSTTTAGLSEKSTTFYSSPRSPDT
TLSPASTTSSGVSEESTTSHSRPGSMHTTAFPSSTTMPGVSQESTASHSSPGSTDTTLSP
GSTTASSLGPESTTFHSSPGSTETTLLPDNTTASGLLEASTPVHSSTGSPHTTLSPAGST
TRQGESTTFQSWPNSKDTTPAPPTTTSAFVELSTTSHGSPSSTPTTHFSASSTTLGRSEE
STTVHSSPVATATTPSPARSTTSGLVEESTTYHSSPGSTQTMHFPESNTTSGRGEESTTS
HSSTTHTISSAPSTTSALVEEPTSYHSSPGSTATTHFPDSSTTSGRSEESTASHSSQDAT
GTIVLPARSTTSVLLGESTTSPISSGSMETTALPGSTTTPGLSEKSTTFHSSPSSTPTTH
FSASSTTLGRSEESTTVHSSPVATATTPSPARSTTSGLVEESTAYHSSPGSTQTMHFPES
STASGRSEESRTSHSSTTHTISSPPSTTSALVEEPTSYHSSPGSIATTHFPESSTTSGRS
EESTASHSSPDTNGITPLPAHFTTSGRIAESTTFYISPGSMETTLASTATTPGLSAKSTI
LYSSSRSPDQTLSPASMTSSSISGEPTSLYSQAESTHTTAFPASTTTSGLSQESTTFHSK
PGSTETTLSPGSITTSSFAQEFTTPHSQPGSALSTVSPASTTVPGLSEESTTFYSSPGST
ETTAFSHSNTMSIHSQQSTPFPDSPGFTHTVLPATLTTTDIGQESTAFHSSSDATGTTPL
PARSTASDLVGEPTTFYISPSPTYTTLFPASSSTSGLTEESTTFHTSPSFTSTIVSTESL
ETLAPGLCQEGQIWNGKQCVCPQGYVGYQCLSPLESFPVETPEKLNATLGMTVKVTYRNF
TEKMNDASSQEYQNFSTLFKNRMDVVLKGDNLPQYRGVNIRRLLNGSIVVKNDVILEADY
TLEYEELFENLAEIVKAKIMNETRTTLLDPDSCRKAILCYSEEDTFVDSSVTPGFDFQEQ
CTQKAAEGYTQFYYVDVLDGKLACVNKCTKGTKSQMNCNLGTCQLQRSGPRCLCPNTNTH
WYWGETCEFNIAKSLVYGIVGAVMAVLLLALIILIILFSLSQRKRHREQYDVPQEWRKEG
TPGIFQKTAIWEDQNLRESRFGLENAYNNFRPTLETVDSGTELHIQRPEMVASTV
NT seq 16008 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgatctggattctgacgctggctctccggctctgcgcgtccgttactacagtg
acaccaggctcaacagtaaacaccagtattggaggtaatacaacttctgcatccacaccc
agttcaagcgacccttttaccacctttagtgactatggggtgtcagtcacatttatcacg
ggctcaactgcaacaaaacacttccttgacagctccacaaactcaggccacagtgaggaa
tcaacagtatcccacagcggcccaggtgcaactggaacaacactcttcccttcccactct
gcaacctcagtttttgttggagaacctaaaacctcacccatcacttcagcctcaatggaa
acaacagcgttacctggcagtaccacaacagcaggcctgagtgagaaatctaccaccttc
tacagtagccccagatcaccagacagaacactctcacctgcccgcacgacaagctcaggc
gtcagtgaaaaatcaaccacctcccacagccgaccaggcccaacgcacacaatagcgttc
cctgacagtaccaccatgccaggcgtcagtcaggaatctacagcttcccacagcatcccc
ggctccacagacacaacactgtcccctggcactaccacaccatcatcccttggtccagaa
tctactaccttccacagcagcccaggctacactaaaacaacacgcttacctgacaacacc
acaacctcaggcctccttgaagcatctacgcccgtccacagcagcactggatcgccacac
acaacactgtccccttccagctctacaacccatgagggagaacctaccaccttccagagc
tggccaagctcaaaggacacttcgcctgcaccttctggtaccacatcagcctttgttaaa
ctatctacaacttatcacagcagcccgagctcaactccaacaacccacttttctgccagc
tccacaaccttgggccatagtgaggaatcgacaccagtccacagcagcccagttgcaact
gcaacaacacccccacctgcccgctccgcgacctcaggccatgttgaagaatctacagcc
taccacaggagcccgggctcaactcaaacaatgcacttccctgaaagctccacaacttca
ggccatagtgaagaatcagcaactttccacggcagcacaacacacacaaaatcttcaact
cctagcaccacagctgccctagcacatacaagctaccacagcagcctgggctcaactgaa
acaacacacttccgtgatagctccacaatctcaggccgtagtgaggaatcaaaagcatcc
cacagcagcccagatgcaatggcaacaacagtcttacctgccggctctacaccctcagtt
cttgttggagactcgacgccctcacccatcagttcaggctcaatggaaaccacagcgtta
cccggcagtaccacaaaaccaggcctcagtgagaaatctaccactttctacagtagcccc
agatcaccagacacaacacacttacctgccagcatgacaagctcaggcgtcagtgaagaa
tccaccacctcccacagccgaccaggctcaacacacacaacagcattccctggcagtacc
accatgccaggcctcagtcaggaatctacagcttcccacagcagcccaggccccacagac
acaacattgtcccctggcagtaccacagcatcatcccttggtccagaatatactaccttc
cacagccgcccaggctccactgaaacaacactcttacctgacaacaccacagcctcagga
ctccttgaagcatctatgcccgtccacagcagcaccagatcgccacacacaacactgtcc
cctgccggctctacaacccgtcagggagaatctaccacattccatagctggccaagctca
aaggacactaggcctgcacctcctactaccacatcagcctttgttgagccatctacaacc
tcccacggcagcccgagctcaattccaacaacccacatttctgcccgctccacaacctca
ggcctcgttgaagaatctacgacctaccacagcagcccgggctcaactcaaacaatgcac
ttccctgaaagcgacacaacttcaggccgtggtgaagaatcaacaacttcccacagcagc
acaacacacacaatatcttcagctcctagcaccacatctgcccttgttgaagaacctacc
agctaccacagcagcccgggctcaactgcaacaacacacttccctgacagctccacaacc
tcaggccgtagtgaggaatcaacagcatcgcacagcagccaagacgcaacgggaacaata
gtcctacctgcccgctccacaacctcagttcttcttggagaatctacgacctcacccatc
agttcaggctcaatggaaacgacagcgttacccggcagtaccacaacgccaggcctcagt
gagagatctaccactttccatagtagccccagatcaccagccacaacactctcacctgcc
agcacgacaagctcaggcgtcagtgaagaatccaccacctcccgcagccgaccaggctca
acgcacacaacagcattccctgacagcaccaccacgccaggcctcagtcggcattctaca
acttcccacagcagcccaggctcaacggatacaacactgttacctgccagcaccaccacc
tcaggccccagtcaggaatcaacaacttcccacagcagctcaggttcaactgacacagca
ctgtcccctggcagtaccacagccttatcctttggtcaagaatctacaaccttccacagc
aacccaggctccactcacacaacactcttccctgacagcaccacaagctcaggcatcgtt
gaagcatctacacgcgtccacagcagcactggctcaccacgcacaacactgtcccctgcc
agctccacaagccctggacttcagggagaatctactgccttccagacccacccagcctca
actcacacaacgccttcacctcctagcaccgcaacagcccctgttgaagaatctacaacc
taccaccgcagcccaggctcgactccaacaacacacttccctgccagctccacaacttcg
ggccacagtgagaaatcaacaatattccacagcagcccagatgcaagtggaacaacaccc
tcatctgcccactccacaacctcaggtcgtggagaatctacaacctcacgcatcagtcca
ggctcaactgaaataacaacgttacctggcagtaccacaacaccaggcctcagtgaggca
tctaccaccttctacagcagccccagatcaccaaccacaacactctcacctgccagcatg
acaagcctgggcgtcggtgaagaatccaccacctcccgtagccaaccaggttctactcac
tcaacagtgtcacctgccagcaccaccacgccaggcctcagtgaggaatctaccaccgtc
tacagcagcagccgaggctcaactgaaaccacagtgttccctcacagcaccacaacctca
gttcatggtgaagagcctacaaccttccacagccggccagcctcaactcacacaacactg
ttcactgaggacagcaccacctcgggcctcactgaagaatctacagccttccccggcagc
ccagcctccacccaaacagggttacctgccacactcacaaccgcagacctcggtgaggaa
tcaactacctttcccagcagctcaggctcaactggaacaaaactctcacctgcccgctcc
accacctctggcctcgttggagaatccacaccctcacgcctcagtccaagctcaaccgaa
acaacaactttacctggcagtcccacaacaccaagcctcagtgagaaatcaaccaccttc
tacactagccccagatcaccagatgcaacactctcacctgcaaccacaacaagctcaggc
gtcagcgaagaatccagcacatcccacagtcaaccaggctcaacgcacacaacagcattc
cctgacagcaccaccacctcagacctcagtcaggaacctacaacttcccacagcagccaa
ggctcaacagaggcaacactgtcccctggcagtaccacagcctcatcccttggtcaacaa
tctacaaccttccacagcagcccaggcgacactgaaaccacactcttacctgacgacacc
ataacctcaggcctcgtggaggcatctacacccacccacagcagcactggctcgctacac
acaacactgacccctgccagctccacaagcgctggccttcaggaagaatctaccactttc
cagagctggccaagctcaagtgacacaacaccttcacctcccggcaccacagcagcccct
gttgaagtatccacaacctaccacagccgcccgagctcaactccaacaacacacttttct
gccagttccacaaccttgggccgtagtgaggaatcaacaacagtccacagcagcccaggt
gcaactggaacagcactcttccctacccgctctgcaacctcagttcttgttggagaacct
acaacgtcacccatcagttcaggctcaacggaaacaacagcgttacctggcagtaccaca
acagcaggcctgagtgagaaatctaccaccttctacagtagccccagatcaccggacaca
acactctcacctgccagcacgacaagctcaggcgtcagtgaagaatccaccacctcccac
agccgaccaggctcaacgcacacaacagcattccctggcagtaccaccatgccaggcgtc
agtcaggaatctacagcttcccacagcagcccaggctccacagacacaacattgtcccct
ggcagtaccacagcatcatcccttggtccagaatctactactttccacagcagcccaggc
tccactgaaacaacactcttacctgacaacaccacagcctcaggcctccttgaagcatct
acgcccgtccacagcagcactggatcgccacacacaacactgtcccctgccggctctaca
acacgtcagggagaatctaccaccttccagagctggccaagctcaaaggacactatgcct
gcacctcctactaccacatcagcctttgttgagctatctacaacctcccacggcagcccg
agctcaactccaacaacccacttttctgccagctccacaaccttgggccgtagtgaggaa
tcgacaacagtccacagcagcccagttgcaactgcaacaacaccctcgcctgcccgctcc
acaacctcaggcctcgttgaagaatctacggcgtaccacagcagcccgggctcaactcaa
acaatgcacttccctgaaagctccacagcttcaggtcgtagtgaagaatcaagaacttcc
cacagcagcacaacacacacaatatcttcacctcctagcaccacatctgcccttgttgaa
gaacctaccagctaccacagcagcccgggctcaactgcaacaacacacttccctgacagc
tccacaacctcaggccgtagtgaggaatcaacagcatcccacagcagccaagacgcaacg
ggaacaatagtcctacctgcccgctccacaacctcagttcttcttggagaatctacgacc
tcacccatcagttcaggctcaatggaaacgacagcgttacccggcagtaccacaacgcca
ggcctcagtgagaaatctaccactttccacagtagccccagatcaccagccacaacactc
tcacctgccagcacgacaagctcaggcgtcagtgaagaatccaccacctcccacagccga
ccaggctcaacgcacacaacagcattccctgacagcaccaccacgccaggcctcagtcgg
cattctacaacttcccacagcagcccaggctcaacggatacaacactgttacctgccagc
accaccacctcaggccccagtcaggaatcaacaacttcccacagcagcccaggttcaact
gacacagcactgtcccctggcagtaccacagccttatcctttggtcaagaatctacaacc
ttccacagcagcccaggctccactcacacaacgctcttccctgacagcaccacaagctca
ggcatcgttgaagcatctacacgcgtccacagcagcactggctcaccacgcacaacactg
tcccctgccagctccacaagccctggacttcagggagaatctaccgccttccagacccac
ccagcctcaactcacacgacgccttcacctcctagcaccgcaacagcccctgttgaagaa
tctacaacctaccaccgcagcccaggctcgactccaacaacacacttccctgccagctcc
acaacttcgggccacagtgagaaatcaacaatattccacagcagcccagatgcaagtgga
acaacaccctcatctgcccactccacaacctcaggtcgtggagaatctacaacctcacgc
atcagtccaggctcaactgaaataacaacgttacctggcagtaccacaacaccaggcctc
agtgaggcatctaccaccttctacagcagccccagatcaccaaccacaacactctcacct
gccagtatgacaagcctaggcgtcggtgaagaatccaccacctcccgtagccaaccaggt
tctactcactcaacagtgtcacctgccagcaccaccacgccaggcctcagtgaggaatct
accaccgtctacagcagcagcccaggctcaactgaaaccacagtgttccctcgcaccccc
acaacctcagttcgtggtgaagagcctacaaccttccacagccggccagcctcaactcac
acaacactgttcactgaggacagcaccacctcgggcctcactgaagaatctacagccttc
cccggcagcccagcctccacccaaacagggttacctgccacactcacaaccgcagacctc
ggtgaggaatcaactacctttcccagcagctcaggctcaactggaacaacactctcacct
gcccgctccaccacctctggcctcgttggagaatccacaccctcacgcctcagtccaagc
tcaaccgaaacaacaactttacccggcagtcccacaacaccaagcctcagtgagaaatca
accaccttctacactagccccagatcaccagatgcaacactctcacctgcaaccacaaca
agctcaggcgtcagtgaagaatccagcacatcccacagtcaaccaggctcaacgcacaca
acagcattccctgacagcaccaccacgccaggcctcagtcggcattctacaacttcccac
agcagcccaggctcaacggatacaacactgttacctgccagcaccaccacctcaggcccc
agtcaggaatcaacaacttcccacagcagcccaggttcaactgacacagcactgtcccct
ggcagtaccacagccttatcctttggtcaagaatctacaaccttccacagcagcccaggc
tccactcacacaacactcttccctgacagcaccacaagctcaggcatcgttgaagcatct
acacgcgtccacagcagcactggctcaccacgcacaacactgtcccctgccagctccaca
agccctggacttcagggagaatctaccaccttccagacccacccagcctcaactcacacg
acgccttcacctcctagcaccgcaacagcccctgttgaagaatctacaacctaccaccgc
agcccaggctcgactccaacaacacacttccctgccagctccacaacttcgggccacagt
gagaaatcaacaatattccacagcagcccagatgcaagtggaacaacaccctcatctgcc
cactccacaacctcaggtcgtggagaatctacaacctcacgcatcagtccaggctcaact
gaaataacaacgttacctggcagtaccacaacaccaggcctcagtgaggcatctaccacc
ttctacagcagccccagatcaccaaccacaacactctcacctgccagtatgacaagccta
ggcgtcggtgaagaatccaccacctcccgtagccaaccaggttctactcactcaacagtg
tcacctgccagcaccaccacgccaggcctcagtgaggaatctaccaccgtctacagcagc
agcccaggctcaactgaaaccacagtgttccctcgcagcaccacaacctcagttcgtggt
gaagagcctacaaccttccacagccggccagcctcaactcacacaacactgttcactgag
gacagcaccacctcgggcctcactgaagaatctacagccttccccggcagcccagcctcc
acccaaacagggttacctgccacactcacaaccgcagacctcggtgaggaatcaactacc
tttcccagcagctcaggctcaactggaacaacactctcacctgcccgctccaccacctct
ggcctcgttggagaatccacaccctcacgcctcagtccaagctcaaccgaaacaacaact
ttacccggcagtcccacaacaccaagcctcagtgagaaatcaaccaccttctacactagc
cccagatcaccagatgcaacactctcacctgcaaccacaacaagctcaggcgtcagtgaa
gaatccagcacatcccacagtcaaccaggctcaacgcacacaacagcgttccctgacagc
accaccacctcaggcctcagtcaggaacctacagcttcccacagcagccaaggctcaaca
gaggcaacactgtcccctggcagtaccacagcctcatcccttggtcaacaatctacaacc
ttccacagcagcccaggcgacactgaaaccacactcttacctgacgacaccataacctca
ggcctcgtggaggcatctacacccacccacagcagcactggctcgctacacacaacactg
acccctgccagctccacaagcgctggccttcaggaagaatctaccactttccagagctgg
ccaagctcaagtgacacaacaccttcacctcccggcaccacagcagcccctgttgaagta
tccacaacctaccacagccgcccgagctcaactccaacaacacacttttctgccagttcc
acaaccttgggccgtagtgaggaatcaacaacagtccacagcagcccaggtgcaactgga
acagcactcttccctacccgctctgcaacctcagttcttgttggagaacctacaacgtca
cccatcagttcaggctcaacggaaacaacagcgttacctggcagtaccacaacagcaggc
ctgagtgagaaatctaccaccttctacagtagccccagatcaccggacacaacactctca
cctgccagcacgacaagctcaggcgtcagtgaagaatccaccacctcccacagccgacca
ggctcaacgcacacaacagcattccctggcagtaccaccatgccaggcgtcagtcaggaa
tctacagcttcccacagcagcccaggctccacagacacaacactgtcccctggcagtacc
acagcatcatcccttggtccagaatctactaccttccacagcggcccaggctccactgaa
acaacactcttacctgacaacaccacagcctcaggcctccttgaagcatctacgcccgtc
cacagcagcactggatcgccacacacaacactgtcccctgccggctctacaacccgtcag
ggagaatctaccaccttccagagctggcctaactcgaaggacactacccctgcacctcct
actaccacatcagcctttgttgagctatctacaacctcccacggcagcccgagctcaact
ccaacaacccacttttctgccagctccacaaccttgggccgtagtgaggaatcgacaaca
gtccacagcagcccagttgcaactgcaacaacaccctcgcctgcccgctccacaacctca
ggcctcgttgaagaatctacgacctaccacagcagcccgggctcaactcaaacaatgcac
ttccctgaaagcgacacaacttcaggccgtggtgaagaatcaacaacttcccacagcagc
acaacacacacaatatcttcagctcctagcaccacatctgcccttgttgaagaacctacc
agctaccacagcagcccgggctcaactgcaacaacacacttccctgacagctccacaacc
tcaggccgtagtgaggaatcaacagcatcccacagcagccaagacgcaacgggaacaata
gtcctacctgcccgctccacaacctcagttcttcttggagaatctacgacctcacccatc
agttcaggctcaatggaaacgacagcgttacccggcagtaccacaacgccaggcctcagt
gagaaatctaccactttccacagtagccccagatcaccagccacaacactctcacctgcc
agcacgacaagctcaggcgtcagtgaagaatccaccacctcccacagccgaccaggctca
acgcacacaacagcattccctgacagcaccaccacgccaggcctcagtcggcattctaca
acttcccacagcagcccaggctcaacggatacaacactgttacctgccagcaccaccacc
tcaggctccagtcaggaatcaacaacttcccacagcagctcaggttcaactgacacagca
ctgtcccctggcagtaccacagccttatcctttggtcaagaatctacaaccttccacagc
agcccaggctccactcacacaacactcttccctgacagcaccacaagctcaggcatcgtt
gaagcatctacacgcgtccacagcagcactggctcaccacgcacaacactgtcccctgcc
agctccacaagccctggacttcagggagaatctaccgccttccagacccacccagcctca
actcacacgacgccttcacctcctagcaccgcaacagcccctgttgaagaatctacaacc
taccaccgcagcccaggctcgactccaacaacacacttccctgccagctccacaacttcg
ggccacagtgagaaatcaacaatattccacagcagcccagatgcaagtggaacaacaccc
tcatctgcccactccacaacctcaggtcgtggagaatctacaacctcacgcatcagtcca
ggctcaactgaaataacaacgttacctggcagtaccacaacaccaggcctcagtgaggca
tctaccaccttctacagcagccccagatcaccaaccacaacactctcacctgccagtatg
acaagcctaggcgtcggtgaagaatccaccacctcccgtagccaaccaggttctactcac
tcaacagtgtcacctgccagcaccaccacgccaggcctcagtgaggaatctaccaccgtc
tacagcagcagcccaggctcaactgaaaccacagtgttccctcgcagcaccacaacctca
gttcgtcgtgaagagcctacaaccttccacagccggccagcctcaactcacacaacactg
ttcactgaggacagcaccacctcgggcctcactgaagaatctacagccttccccggcagc
ccagcctccacccaaacagggttacctgccacactcacaaccgcagacctcggtgaggaa
tcaactacctttcccagcagctcaggctcaactggaacaaaactctcacctgcccgctcc
accacctctggcctcgttggagaatccacaccctcacgcctcagtccaagctcaaccgaa
acaacaactttacccggcagtcccacaacaccaagcctcagtgagaaatcaaccaccttc
tacactagccccagatcaccagatgcaacactctcacctgcaaccacaacaagctcaggc
gtcagcgaagaatccagcacatcccacagtcaaccaggctcaacgcacacaacagcgttc
cctgacagcaccaccacctcaggcctcagtcaggaacctacaacttcccacagcagccaa
ggctcaacagaggcaacactgtcccctggcagtaccacagcctcatcccttggtcaacaa
tctacaaccttccacagcagcccaggcgacactgaaaccacactcttacctgacgacacc
ataacctcaggcctcgtggaggcatctacacccacccacagcagcactggctcgctacac
acaacactgacccctgccagctccacaagcactggccttcaggaagaatctaccactttc
cagagctggccaagctcaagtgacacaacaccttcacctcccagcaccacagcagtccct
gttgaagtatccacaacctaccacagccgcccgagctcaactccaacaacacacttttct
gccagttccacaaccttgggccgtagtgaggaatcaacaacagtccacagcagcccaggt
gcaactggaacagcactcttccctacccgctctgcaacctcagttcttgttggagaacct
acaacgtcacccatcagttcaggctcaacggaaacaacagcgttacctggcagtaccaca
acagcaggcctgagtgagaaatctaccaccttctacagtagccccagatcaccggacaca
acactttcacctgccagcacgacaagctcaggcgtcagtgaagaatccaccacctcccac
agccgaccaggctcaatgcacacaacagcattccctagcagtaccaccatgccaggcgtc
agtcaggaatctacagcttcccacagcagcccaggctccacagacacaacactgtcccct
ggcagtaccacagcatcatcccttggtccagaatctactaccttccacagcagcccaggc
tccactgaaacaacactcttacctgacaacaccacagcctcaggcctccttgaagcatct
acacccgtccacagcagcactggatcgccacacacaacactgtcccctgccggctctaca
acccgtcagggagaatctaccaccttccagagctggccaaactcgaaggacactacccct
gcacctcctactaccacatcagcctttgttgagctatctacaacctcccacggcagcccg
agctcaactccaacaacccacttttctgccagctccacaacattgggccgtagtgaggaa
tcgacaacagtccacagcagcccagttgcaactgcaacaacaccctcgcctgcccgctcc
acaacctcaggcctcgttgaagaatctacgacctaccacagcagcccgggctcaactcaa
acaatgcacttccctgaaagcaacacaacttcaggccgtggtgaagaatcaacaacttcc
cacagcagcacaacacacacaatatcttcagctcctagcaccacatctgcccttgttgaa
gaacctaccagctaccacagcagcccgggctcaactgcaacaacacacttccctgacagc
tccacaacctcaggccgtagtgaggaatcaacagcatcccacagcagccaagacgcaacg
ggaacaatagtcctacctgcccgctccacaacctcagttcttcttggagaatctacgacc
tcacccatcagttcaggctcaatggaaacgacagcgttacccggcagtaccacaacgcca
ggcctcagtgagaaatctaccactttccacagtagcccgagctcaactccaacaacccac
ttttctgccagctccacaaccttgggccgtagtgaggaatcgacaacagtccacagcagc
ccagttgcaactgcaacaacaccctcgcctgcccgctccacaacctcaggcctcgttgaa
gaatctacggcgtaccacagcagcccgggctcaactcaaacaatgcacttccctgaaagc
tccacagcttcaggtcgtagtgaagaatcaagaacttcccacagcagcacaacacacaca
atatcttcacctcctagcaccacatctgcccttgttgaagaacctaccagctaccacagc
agcccgggctcaattgcaacaacacactttcctgagagctccacaacctccggccgtagt
gaggaatcaacagcatcccacagcagcccagatacaaatggaatcacacccttacctgcc
cattttactacctcaggccgcattgcagaatctaccaccttctatatctctccaggctca
atggaaacaacattagccagcactgccacaacaccaggcctcagtgcaaaatctaccatc
ctttacagtagctccagatcaccagaccaaacactctcacctgccagcatgacaagctcc
agcatcagtggagaacccaccagcttgtatagccaagcagagtcaacacacacaacagcg
ttccctgccagcaccaccacctcaggcctcagtcaggaatcaacaactttccacagtaag
ccaggctcaactgagacaacactgtcccctggcagcatcacaacttcatcttttgctcaa
gaatttaccacccctcatagccaaccaggctcagctctgtcaacagtgtcacctgccagc
accacagtgccaggccttagtgaggaatctaccaccttctacagcagcccaggctcaact
gaaaccacagcgttttctcacagcaacacaatgtccattcatagtcaacaatctacaccc
ttccctgacagcccaggcttcactcacacagtgttacctgccaccctcacaaccacagac
attggtcaggaatcaacagccttccacagcagctcagacgcaactggaacaacaccctta
cctgcccgctccacagcctcagaccttgttggagaacctacaactttctacatcagccca
tcccctacttacacaacactctttcctgcgagttccagcacatcaggcctcactgaggaa
tctaccaccttccacaccagtccaagcttcacttctacaattgtgtctactgaaagcctg
gaaaccttagcaccagggttgtgccaggaaggacaaatttggaatggaaaacaatgcgtc
tgtccccaaggctacgttggttaccagtgcttgtcccctctggaatccttccctgtagaa
accccggaaaaactcaacgccactttaggtatgacagtgaaagtgacttacagaaatttc
acagaaaagatgaatgacgcatcctcccaggaataccagaacttcagtaccctcttcaag
aatcggatggatgtcgttttgaagggcgacaatcttcctcagtatagaggggtgaacatt
cggagattgctcaacggtagcatcgtggtcaagaacgatgtcatcctggaggcagactac
actttagagtatgaggaactgtttgaaaacctggcagagattgtaaaggccaagattatg
aatgaaactagaacaactcttcttgatcctgattcctgcagaaaggccatactgtgctat
agtgaagaggacactttcgtggattcatcggtgactccgggctttgacttccaggagcaa
tgcacccagaaggctgccgaaggatatacccagttctactatgtggatgtcttggatggg
aagctggcctgtgtgaacaagtgcaccaaaggaacgaagtcgcaaatgaactgtaacctg
ggcacatgtcagctgcaacgcagtggcccccgctgcctgtgcccaaatacgaacacacac
tggtactggggagagacctgtgaattcaacatcgccaagagcctcgtgtatgggatcgtg
ggggctgtgatggcggtgctgctgctcgcattgatcatcctaatcatcttattcagccta
tcccagagaaaacggcacagggaacagtatgatgtgcctcaagagtggcgaaaggaaggc
acccctggcatcttccagaagacggccatctgggaagaccagaatctgagggagagcaga
ttcggccttgagaacgcctacaacaacttccggcccaccctggagactgttgactctggc
acagagctccacatccagaggccggagatggtagcatccactgtgtga

DBGET integrated database retrieval system