KEGG   Homo sapiens (human): 10072Help
Entry
10072             CDS       T01001                                 

Gene name
DPP3, DPPIII
Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10072 (DPP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     10072 (DPP3)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   10072 (DPP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 10072
NCBI-ProteinID: NP_005691
OMIM: 606818
HGNC: 3008
Ensembl: ENSG00000254986
Vega: OTTHUMG00000167143
Pharos: Q9NY33(Tbio)
UniProt: Q9NY33
Structure
PDB: 

Position
11q13.2
AA seq 737 aa AA seqDB search
MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIY
ALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPK
EKLERVILGSEAAQQHPEEVRGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMED
AKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLGSEPSLDSEVTSKLKSYEFR
GSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQYIESFTQGSIEAHKRGSRFW
IQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASAEQLLKELPWP
PTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQ
REKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPE
TGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIY
VNWLNMVRAGLLALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPD
ARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRD
TVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEILTQLAT
ADARFWKGPSEAPSGQA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcggacacccagtacatcctgcccaatgacatcggcgtgtctagcctggactgccgt
gaggccttccgcctgctgtcacccacagagcgcctctatgcctaccacctgtcccgtgcc
gcctggtacggaggcctggctgtgctgcttcagacctcccctgaggccccctacatctat
gctctgctcagccgcctcttccgcgcccaggaccccgaccagctgcgccaacatgccctg
gctgaaggccttaccgaggaggagtatcaggcgttcctggtctatgccgcgggtgtttac
tccaacatgggcaactacaagtcctttggtgacaccaagtttgttcccaacttgcccaag
gaaaagctggaacgggtgatcctagggagtgaggctgctcagcagcacccagaagaagtc
aggggcctctggcagacctgcggggagcttatgttctctctggagccaaggcttcgacac
ctcggactggggaaggagggaatcaccacctatttctctgggaattgtaccatggaagat
gccaaattggcccaggactttctggactcacagaacctcagtgcctacaacacccggctc
ttcaaagaggtcgatggagaagggaagccctactacgaggtgcggctggcttctgtgctt
ggctcagagccttccctggactctgaggtgacttccaagctgaagagctatgaattccgg
ggaagccctttccaggtgacccggggggactacgcgcccatcctccagaaggtggtggag
cagctggagaaagccaaggcctatgcagccaacagccaccaggggcagatgctggcccag
tatatagagagcttcacccagggctccatcgaggcccacaagaggggctcccgcttctgg
atccaggacaaaggccccatcgtggagagttacatcgggttcatcgagagctaccgcgac
ccctttggttcccgaggagaatttgaaggtttcgtagctgtggtgaacaaggccatgagt
gccaagtttgagcggctggtggcgagcgcagagcagctgctgaaggagctgccctggccc
ccaacctttgagaaggacaagttcctcacccctgacttcacctccctggatgttctcacc
ttcgctggctccggcatccctgccggcatcaacatccccaactacgatgatctgaggcag
acggaaggctttaagaacgtgtcgctggggaatgtgctggctgtggcctacgccacgcag
cgggagaagcttacctttctggaggaggatgacaaggacctgtacatcctctggaagggg
ccctccttcgatgtgcaggtgggcctgcacgagctgctgggccatggcagtggcaagctc
ttcgtacaggacgaaaaaggagcattcaactttgaccaggaaacagtgatcaacccagag
acgggcgagcagattcagagctggtatcggagcggggagacctgggatagcaagttcagc
accatcgcctccagctacgaagagtgccgggctgagagcgtgggtctctacctctgtctc
cacccgcaagtgctggagatctttggctttgagggggctgatgcggaggacgtgatctac
gtgaactggctcaacatggttcgggccgggctgctcgctctggagttctacacacctgag
gccttcaactggcgacaggcccatatgcaggcccggtttgtgatcctgagagtcttgctg
gaggctggcgagggactcgttaccatcactcccaccacaggctccgatgggcgcccagat
gcccgggtccgcctcgaccgcagcaagatccggtctgtgggcaagcctgctctagagcgc
ttcctgcggagacttcaggtgctgaagtccacaggggatgtggccggagggcgggccctg
tacgaggggtatgcaacagtcactgatgcgccccccgagtgcttcctcaccctcagggac
acggtgctgctgcgtaaggaatctcggaagctcattgttcagcccaacactcgccttgaa
ggctcagacgtgcagcttctggaatacgaggcgtcagctgctggcctcatccgatccttc
tctgagcgtttcccagaggatggacccgagttggaggagatcctcacacagctggccaca
gccgatgcccgattctggaagggccccagtgaggccccatctggccaagcttga

DBGET integrated database retrieval system