KEGG   Homo sapiens (human): 10073Help
Entry
10073             CDS       T01001                                 

Gene name
SNUPN, KPNBL, RNUT1, Snurportin1
Definition
(RefSeq) snurportin 1
  KO
K13151  snurportin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    10073 (SNUPN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10073 (SNUPN)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Other proteins involved in snRNP biogenesis
    10073 (SNUPN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snurportin1 IBB mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 10073
NCBI-ProteinID: NP_001036046
OMIM: 607902
HGNC: 14245
Ensembl: ENSG00000169371
Vega: OTTHUMG00000142833
Pharos: O95149(Tbio)
UniProt: O95149
Structure
PDB: 

Position
15q24.2
AA seq 360 aa AA seqDB search
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVN
HARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWI
VVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVN
QTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPE
SLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKPD
YAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLSTPKLKGSSHSPDHPGCLMEN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaagagttgagtcaggccctggctagtagcttttctgtgtctcaagatctgaacagc
acagctgccccacacccccgcctatcccagtacaagtccaagtacagttccttggagcag
agtgagcgccgccggaggttactggaactgcagaaatccaagcggctggattatgtgaac
catgccagaagactggctgaagatgactggacagggatggagagtgaggaagaaaataag
aaagatgatgaagaaatggacattgacactgtcaagaagttaccaaaacactatgctaat
caattgatgctttctgagtggttaattgacgttccttcagatttggggcaggaatggatt
gtggtcgtgtgccctgttggaaaaagagcccttatcgtggcctccaggggttctaccagt
gcctacaccaagagtggctactgtgtcaacaggttttcttcacttctgccaggaggcaac
aggcgaaactcaacagcaaaagactacaccattctagattgcatttacaatgaggtaaac
cagacctactacgttctggatgtgatgtgctggcggggacaccctttttatgattgccag
actgatttccgattctactggatgcattcaaagttaccagaagaagaaggactgggagag
aaaaccaagcttaatccttttaaatttgtggggctaaagaacttcccttgcactcccgaa
agcctgtgtgatgtgctatctatggatttcccttttgaggtagatggacttctcttctac
cacaaacagacccactacagccccggaagcactcccttggtgggctggctgcgcccctac
atggtgtcagatgtccttggtgtagctgtgccggctggcccgctgaccaccaagccagac
tatgctgggcaccagctccagcagattatggagcacaagaagagccagaaggaaggcatg
aaggagaaactcacacacaaggcctctgagaatgggcactatgaattggagcacctgtct
actcccaagttgaagggttcttcccatagcccagaccaccctggatgcctcatggagaat
taa

DBGET integrated database retrieval system