KEGG   Homo sapiens (human): 10075Help
Entry
10075             CDS       T01001                                 

Gene name
HUWE1, ARF-BP1, HECTH9, HSPC272, Ib772, LASU1, MULE, URE-B1, UREB1
Definition
(RefSeq) HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase
  KO
K10592  E3 ubiquitin-protein ligase HUWE1 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Disease
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10075 (HUWE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10075 (HUWE1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     10075 (HUWE1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   10075 (HUWE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF913 HECT UBM DUF908 WWE UBA Ku_C
Motif
Other DBs
NCBI-GeneID: 10075
NCBI-ProteinID: NP_113584
OMIM: 300697
HGNC: 30892
Ensembl: ENSG00000086758
Vega: OTTHUMG00000021617
Pharos: Q7Z6Z7(Tbio)
UniProt: Q7Z6Z7 A0A024R9W5
Structure
PDB: 

Position
Xp11.22
AA seq 4374 aa AA seqDB search
MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDR
FDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLA
ECCRDLHMMKYPPSATTLHFEFYADPGAEVKIEKRTTSNTLHYIHIEQLDKISESPSEIM
ESLTKMYSIPKDKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSIIDCTGTASYHGFLP
VLVRNCIQAMIDPSMDPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQ
RPNTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSL
KHIISNAEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREV
LGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNLG
SAVDELMRHQPTLKTDATTAIIKLLEEICNLGRDPKYICQKPSIQKADGTATAPPPRSNH
AAEEASSEDEEEEEVQAMQSFNSTQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESI
LSNNTTDDHCQEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKV
LQEGLLQLDSILSSLEPLHRPIESPGGSVLLRELACAGNVADATLSAQATPLLHALTAAH
AYIMMFVHTCRVGQSEIRSISVNQWGSQLGLSVLSKLSQLYCSLVWESTVLLSLCTPNSL
PSGCEFGQADMQKLVPKDEKAGTTQGGKRSDGEQDGAAGSMDASTQGLLEGIGLDGDTLA
PMETDEPTASDSKGKSKITPAMAARIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVR
QRRSHHAASTTTAPTPAARSTASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSP
MLFDERKYPYHLMLQKFLCSGGHNALFETFNWALSMGGKVPVSEGLEHSDLPDGTGEFLD
AWLMLVEKMVNPTTVLESPHSLPAKLPGGVQNFPQFSALRFLVVTQKAAFTCIKNLWNRK
PLKVYGGRMAESMLAILCHILRGEPVIRERLSKEKEGSRGEEDTGQEEGGSRREPQVNQQ
QLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHPPPIMGGVVRDLSMSEEDQMMRAIA
MSLGQDIPMDQRAESPEEVACRKEEEERKAREKQEEEEAKCLEKFQDADPLEQDELHTFT
DTMLPGCFHLLDELPDTVYRVCDLIMTAIKRNGADYRDMILKQVVNQVWEAADVLIKAAL
PLTTSDTKTVSEWISQMATLPQASNLATRILLLTLLFEELKLPCAWVVESSGILNVLIKL
LEVVQPCLQAAKEQKEVQTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNSNNWRWF
DDRSGRWCSYSASNNSTIDSAWKSGETSVRFTAGRRRYTVQFTTMVQVNEETGNRRPVML
TLLRVPRLNKNSKNSNGQELEKTLEESKEMDIKRKENKGNDTPLALESTNTEKETSLEET
KIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKS
TRMILNLTQSSGFNGFTPLVTLLLRHIIEDPCTLRHTMEKVVRSAATSGAGSTTSGVVSG
SLGSREINYILRVLGPAACRNPDIFTEVANCCIRIALPAPRGSGTASDDEFENLRIKGPN
AVQLVKTTPLKPSPLPVIPDTIKEVIYDMLNALAAYHAPEEADKSDPKPGVMTQEVGQLL
QDMGDDVYQQYRSLTRQSSDFDTQSGFSINSQVFAADGASTETSASGTSQGEASTPEESR
DGKKDKEGDRASEEGKQKGKGSKPLMPTSTILRLLAELVRSYVGIATLIANYSYTVGQSE
LIKEDCSVLAFVLDHLLPHTQNAEDKDTPALARLFLASLAAAGSGTDAQVALVNEVKAAL
GRALAMAESTEKHARLQAVMCIISTIMESCPSTSSFYSSATAKTQHNGMNNIIRLFLKKG
LVNDLARVPHSLDLSSPNMANTVNAALKPLETLSRIVNQPSSLFGSKSASSKNKSEQDAQ
GASQDSSSNQQDPGEPGEAEVQEEDHDVTQTEVADGDIMDGEAETDSVVIAGQPEVLSSQ
EMQVENELEDLIDELLERDGGSGNSTIIVSRSGEDESQEDVLMDEAPSNLSQASTLQANR
EDSMNILDPEDEEEHTQEEDSSGSNEDEDDSQDEEEEEEEDEEDDQEDDEGEEGDEDDDD
DGSEMELDEDYPDMNASPLVRFERFDREDDLIIEFDNMFSSATDIPPSPGNIPTTHPLMV
RHADHSSLTLGSGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRL
LGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGT
LSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLEFLRDEELEERREKRRKQLAEE
ETKITDKGKEDKENRDQSAQCTASKSNDSTEQNLSDGTPMPDSYPTTPSSTDAATSESKE
TLGTLQSSQQQPTLPTPPALGEVPQELQSPAGEGGSSTQLLMPVEPEELGPTRPSGEAET
TQMELSPAPTITSLSPERAEDSDALTAVSSQLEGSPMDTSSLASCTLEEAVGDTSAAGSS
EQPRAGSSTPGDAPPAVAEVQGRSDGSGESAQPPEDSSPPASSESSSTRDSAVAISGADS
RGILEEPLPSTSSEEEDPLAGISLPEGVDPSFLAALPDDIRREVLQNQLGIRPPTRTAPS
TNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNASSDTPMDPVT
FIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSA
LSAILRSPAFTSRLSGNRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLLRLRGRLL
LDHEALSCLLVLLFVDEPKLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSSESELCI
ETPKLTTSEEKGKKSSKSCGSSSHENRPLDLLHKMESKSSNQLSWLSVSMDAALGCRTNI
FQIQRSGGRKHTEKHASGGSTVHIHPQAAPVVCRHVLDTLIQLAKVFPSHFTQQRTKETN
CESDRERGNKACSPCSSQSSSSGICTDFWDLLVKLDNMNVSRKGKNSVKSVPVSAGGEGE
TSPYSLEASPLGQLMNMLSHPVIRRSSLLTEKLLRLLSLISIALPENKVSEAQANSGSGA
SSTTTATSTTSTTTTTAASTTPTPPTAPTPVTSAPALVAATAISTIVVAASTTVTTPTTA
TTTVSISPTTKGSKSPAKVSDGGSSSTDFKMVSSGLTENQLQLSVEVLTSHSCSEEGLED
AANVLLQLSRGDSGTRDTVLKLLLNGARHLGYTLCKQIGTLLAELREYNLEQQRRAQCET
LSPDGLPEEQPQTTKLKGKMQSRFDMAENVVIVASQKRPLGGRELQLPSMSMLTSKTSTQ
KFFLRVLQVIIQLRDDTRRANKKAKQTGRLGSSGLGSASSIQAAVRQLEAEADAIIQMVR
EGQRARRQQQAATSESSQSEASVRREESPMDVDQPSPSAQDTQSIASDGTPQGEKEKEER
PPELPLLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPV
RDTRESQLAHIKDEPPPLSPAPLTPATPSSLDPFFSREPSSMHISSSLPPDTQKFLRFAE
THRTVLNQILRQSTTHLADGPFAVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVH
VRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYAL
FRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKS
VRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTE
ENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDID
DLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGI
QKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA
NT seq 13125 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagacaggactaaactgaagaagacacctactgaggctcctgcagactgcaga
gccttaatagacaaactcaaagtttgtaatgatgagcaacttctcttggaactgcagcag
atcaaaacatggaacattggaaagtgcgagttatatcactgggtggacctgttggaccgc
ttcgatggaatactggcagatgctggacagacagtggagaatatgtcatggatgctcgta
tgtgataggccagaaagagagcaactgaaaatgcttctcttggctgtgttgaacttcaca
gccttgctcattgagtacagcttttcccggcatctgtacagttccatagagcatttgaca
actttattggcttcctctgatatgcaagtggtgctggcagtcctcaatctcctatatgta
tttagcaaaagatcaaactacatcactcgtctgggatctgacaagaggaccccgctgcta
actcggctacaacatttggcagagagctggggtggaaaggagaatggctttggacttgca
gaatgttgcagagacttgcatatgatgaaatatccacccagtgcaactacactacacttt
gaattctatgcagatcctggggccgaggtcaaaattgagaaaaggacaactagtaacaca
ctacattatattcacatagagcaacttgacaagatttcagaaagcccttctgaaatcatg
gaatctcttaccaaaatgtacagcattcctaaggataagcagatgctgttatttacacac
atacgactggcccatggcttttctaatcacaggaagcgattgcaggcagttcaggccaga
ctgcatgcaatatctatattagtgtattccaatgccttgcaggaatcagcaaacagtatc
ttgtataatggcttgatagaggagttggtagatgtccttcagataacggataagcagctt
atggagattaaagcagcttctttacgaacattaacatcaattgtccacttggagagaact
cccaaactcagcagtattattgactgtactggaactgcctcctaccatggatttttgcca
gtgcttgtaaggaactgtatccaggccatgattgatccttccatggatccataccctcac
cagtttgccactgctctcttctcttttttataccatctggccagctacgatgctggtggt
gaagccttggtctcctgtggaatgatggaagccttattgaaggtcataaagtttcttggc
gatgaacaggaccagataacatttgtcaccagagccgtcagagtggttgaccttatcacc
aacctggatatggcagcttttcaatcccatagtggactttctatcttcatttatagactt
gagcatgaagtagatttgtgccgaaaagaatgtccgtttgtgatcaagccaaagatccag
agacccaatactacacaagaaggagaggaaatggaaactgatatggatggagtccagtgt
attccacaacgagcagcacttctgaaatccatgttgaatttcctcaagaaggccatccaa
gaccctgctttctcagatggcatacgacatgtgatggatggttctctgcctacctccctg
aaacacatcatcagcaatgcagaatactatggcccatcactcttcctcctagctactgaa
gtggtgactgtgtttgtatttcaagaaccatcactgctctcctcactccaggacaatgga
ttgacagatgtcatgctgcatgcactgcttatcaaagatgttcctgctacccgtgaagtc
cttggctccctcccaaatgtattcagtgcactctgtttgaatgcccgaggtcttcagtct
tttgttcagtgtcagccttttgaacgcctcttcaaagttcttctgtctccagattacctc
ccagccatgcggaggaggagaagttctgatccccttggggatactgcatccaacctgggg
agtgctgtcgatgagctcatgagacatcagcccacccttaaaacagatgcaacgactgcc
atcatcaagttacttgaagaaatctgtaatcttggaagggaccccaaatacatctgtcag
aagccatcaatccagaaggcagatggcactgccactgctcctcccccaaggtctaatcat
gccgcagaagaagcctctagtgaggatgaggaggaagaggaagtacaggccatgcagagc
tttaattctacccagcaaaatgaaactgagcctaatcagcaggttgttggtacagaggaa
cgtattcctattcccctcatggattacatccttaatgtgatgaaatttgtggaatctatt
ctgagcaacaatacaacagatgaccactgccaggaatttgtgaatcagaaaggactgttg
cctttggttaccattttgggtcttcccaatctgcccattgactttcccacatctgctgcc
tgtcaggctgttgcaggtgtctgcaaatccatattgacactgtcacatgaacccaaagtc
cttcaagagggtctccttcagttggactccatcctctcctccctggagcccttacaccgc
cccattgaatcccctgggggctcagtgttgttgcgagaactggcttgcgcaggcaatgtt
gctgatgctaccctctcagcccaggccacacctctgctgcatgcactcactgctgcccat
gcctacatcatgatgtttgttcatacttgcagagttggacagagtgaaattcgttccatc
tccgtaaaccagtggggctctcaattgggtctgagtgttttgagcaagctgagccagtta
tactgttccctggtgtgggaaagcactgtcctcctctctctgtgtaccccaaacagccta
ccatctgggtgtgaatttggccaggcagatatgcagaaactggttccaaaggatgagaag
gcaggtacgacccagggcggaaaaagatcagatggggaacaggatggagcagctggaagt
atggatgcttctacccagggcttattagaaggcattgggctagatggtgacacattggct
cccatggagacagatgaacctactgcttcagactctaagggcaaatctaaaatcacacca
gcaatggctgccagaattaagcaaatcaagcctttgttatcagcttcctccagattaggc
cgagcacttgctgagctatttggacttcttgttaaactttgtgtgggatctcctgtccgc
cagagaaggagccatcatgctgccagcaccactacagcaccgacacctgccgcgcgatca
acagcctcagctctcactaagctcttgactaaggggttatcttggcagcccccaccatat
acacctactccccgattcaggctgacattcttcatctgttcagttggtttcacatcccca
atgctgtttgatgagaggaagtatccctaccacctcatgctgcaaaaatttctctgctcc
ggaggccacaatgctctttttgaaactttcaactgggctctgtccatgggaggtaaagtt
cctgtttctgagggattggaacactcagacttgcctgatggcacaggagaattcctagat
gcctggcttatgctggtggagaagatggtgaatcccaccacggtgcttgaatctccacat
tcgctgcctgccaaattgcctggaggtgtccagaactttccccagttcagtgcactgcgc
ttccttgtggtaactcagaaagcagcctttacttgcatcaaaaacttatggaaccggaaa
cccctgaaggtatatggtggacgaatggctgaatcgatgctggccattctatgccacatc
ctccgaggagaacctgtgattcgagagagactaagcaaggagaaggaggggtctcgagga
gaagaggatacagggcaagaggaaggtggctcccgccgggaacctcaagtcaaccagcaa
caactgcaacagctcatggacatgggcttcacaagggaacatgcaatggaggcactgttg
aacaccagcaccatggagcaggccacagagtaccttttaacccaccctcctccaatcatg
ggaggagttgttcgggatctcagcatgtctgaagaggaccagatgatgagagcaattgct
atgtctctgggacaggatattccaatggatcaaagggcagagtcacctgaggaagttgct
tgccggaaggaggaagaggaacggaaagctcgggaaaagcaggaggaggaagaggctaaa
tgtctagagaagttccaggatgctgacccgttggaacaagatgagctccacactttcaca
gatactatgttgccaggctgcttccaccttcttgatgagctgccagacacagtataccgt
gtgtgtgacctgatcatgacagcaatcaaacgtaatggagcagattatcgtgacatgatt
ctgaagcaagtagtcaatcaggtgtgggaagctgctgatgtattgatcaaagctgctctt
cccctgacaacaagtgacacaaaaaccgtgtcagagtggataagtcagatggccacactg
ccccaggcctccaatttggctactagaatcttgcttttaacgctactttttgaggagttg
aagctaccttgtgcttgggtggttgaatcaagtggcatccttaatgtcctaatcaaactc
ttggaagtggttcagccctgcctccaggcagccaaggagcagaaggaagtccagacccca
aagtggatcacaccagtgttgctcctgattgatttctatgaaaagacagccatctcctca
aaaaggagagcccagatgactaagtacctgcaatccaacagcaacaactggcgctggttt
gatgatcgctctgggcgttggtgtagttacagtgcaagcaacaatagcactattgattct
gcctggaaatctggagagacaagcgtgcgattcactgcaggccgaagaagatacacggtc
caattcactacaatggtgcaggttaatgaggaaacagggaaccgacgccctgtgatgctg
actctcctcagggtacctcggctgaataaaaattcaaaaaacagcaatggacaggaacta
gagaagacgctggaagaaagcaaagaaatggatatcaaacgtaaagaaaataaaggcaat
gatacccctttggccctagagagtacaaacactgaaaaggagacaagcctggaggaaaca
aaaatcggggagatcctgatccagggcttgacagaagatatggtgactgttttaatccgg
gcctgcgtgagcatgctgggagtccctgtggacccagatactttgcatgccacccttcgt
ctctgtctgaggctcacccgggaccacaaatatgccatgatgtttgcagaactgaagagt
acccgcatgatcttgaatttgacccagagctcaggcttcaatgggtttactcccctggtc
acccttctcttaagacacatcattgaggacccctgtacccttcgtcataccatggaaaag
gttgttcgctcagcagctacaagtggagctggtagcactacctctggtgttgtgtctggc
agcctcggctctcgggagatcaactacatccttcgtgtccttgggccagccgcatgccgc
aatccagacatattcacagaagtggccaactgctgtatccgcatcgcccttcctgcccct
cgaggctcaggaactgcttcagatgatgaatttgagaatcttagaattaaaggccctaat
gctgtacagctggtgaagaccacccctttgaagccctcacctctgcctgtcatccctgat
actatcaaggaagtgatctatgatatgctgaatgctctggctgcataccatgctccagag
gaagcagataaatctgatcctaaacctggggttatgacccaagaggttggccagctcctg
caagacatgggtgatgatgtataccagcagtaccggtcacttacgcgtcagagcagtgac
tttgatacgcagtcaggtttttccattaatagtcaggtctttgctgcagatggtgcctcc
actgagacttccgcatctgggacctcccaaggagaggcttcaactccagaggagtctcga
gatgggaagaaagataaagaaggggaccgggcctctgaggaaggcaaacagaaaggcaag
ggcagcaaacctttaatgcctacctccactatccttcgtcttctggcagagttggtgagg
tcctatgttggtattgctaccctgattgccaactacagctacactgtgggccagtctgaa
ctgatcaaagaggactgcagtgtgctagcttttgttctggaccacctgctcccacatacc
cagaatgcagaagacaaggacacccctgccttggcccgcctgttcctcgcaagcctggct
gctgcagggagtggcacagatgcccaggtggccctagtgaatgaagtaaaagcagccctt
ggacgggcactggctatggctgagagtacagagaaacatgccaggcttcaggcagtgatg
tgtatcatcagtactatcatggagtcctgcccctccacctccagcttctacagcagtgcc
acagcgaagacccagcacaatggcatgaacaacatcattcggcttttcctgaagaaggga
ctggttaatgacctggccagagtacctcacagcttagacctgtccagtcccaacatggcc
aacacagtcaatgctgctctgaagcctttggaaacactttcccggattgtgaaccagccc
agtagcctttttggcagcaagagtgcttctagcaagaacaagtctgagcaggatgcccaa
ggagcctctcaagattccagtagcaaccagcaggacccaggcgagcctggggaagcagaa
gtgcaggaggaggatcatgatgtcactcagacagaggtggcagatggggatatcatggat
ggggaggctgaaaccgactcagtggtgattgctgggcagcctgaggtgctcagttcacaa
gagatgcaggttgagaatgagctggaggacctgatagatgagttgcttgagagggatggc
ggatctgggaacagtacaattatagtgagcagaagtggagaggatgaatcacaagaggac
gtgctgatggatgaagctccttccaacctcagccaagcttccaccttgcaggccaaccga
gaagattccatgaatatcctggaccctgaggatgaggaggagcacactcaggaagaggac
agcagtggcagtaacgaggatgaggatgatagtcaggatgaagaggaggaggaggaggaa
gatgaggaagatgatcaggaggatgatgaaggtgaagagggagatgaagacgatgacgac
gatggctctgagatggaattggatgaggattatcctgatatgaacgcttctcccttggtc
cgatttgagcgctttgaccgggaggatgatctcatcattgagtttgacaacatgttctcc
agtgctacagacatccccccatccccaggaaatatccctaccacccatccactgatggtg
cgccatgcagaccacagttctctgacactgggcagtggctcttcaacaactcgtctcacc
cagggcatcgggcgcagtcagaggaccctaaggcagctgacggccaatactggccacacc
attcatgttcactaccctgggaatcgccagcccaaccctcctcttatactgcagaggttg
cttggtccctcagctgctgctgacatccttcagctgagcagcagccttcccctacaaagc
cggggtcgggcccgcctcctggtaggcaacgatgacgtccacatcatcgcccgttctgat
gatgagctgctggatgactttttccatgatcagagcacagctaccagccaagcaggaacc
ctgtccagcatccccacagccctgacccgctggacagaagaatgcaaagttctcgatgct
gagagcatgcatgactgtgtttcagtggttaaagtgtccattgtcaatcacctggaattc
ctgagggatgaggagctggaagaaaggcgagagaagcgcaggaaacaactggctgaggaa
gaaacaaagataactgataaaggcaaagaagataaggagaacagggatcagagtgcacag
tgtactgcatctaagtcaaatgactccactgaacagaatctctcagatgggacgcctatg
cctgacagctacccaacaaccccatcttcaactgatgcagctacatctgagtccaaggag
acccttggcactctgcaatcctcacaacagcaaccaacactcccaaccccaccagctttg
ggagaggttcctcaggagctgcagtctccagctggagaagggggcagctctacacagcta
ttgatgcctgtagagccagaggaattgggtcccacaaggccaagtggggaagcagaaaca
actcagatggagttatccccagctcccactataacctcactttccccagagagagctgag
gattctgatgcactgacggctgtcagcagtcagctagaaggctctcctatggatacaagc
agcctggcttcctgtaccttagaggaggctgtgggtgacacttcagcagctggcagttct
gagcagcccagagcaggcagctccactcctggggatgccccaccagctgtggcggaagtg
caaggcaggagtgatgggtcaggggaatctgcccagccacctgaggacagctccccacct
gcatcctctgagagctcttccaccagagattctgccgtggccatttctggagcagattcc
cgaggaatcctagaagagccgttgccttcaacaagcagtgaagaagaagatccccttgcg
ggtatcagtctccctgaaggtgtggacccctcttttctggctgccctgcctgatgacatc
cgtcgggaagttctacagaaccagctaggcattcgtccaccaacccggactgccccctcc
acaaatagctcagcgcctgcagtggtggggaatcctggtgtgactgaagtgagccctgag
tttctggctgccctgcctccagccattcaggaggaagtactggcacagcagagagctgag
cagcagcgacgagaactagcacagaatgccagctcagacacccctatggaccctgtgacc
ttcatccagactctgccctcagacctgcgccgtagtgtcctagaggatatggaggacagt
gtgttagctgtgatgccacctgacattgcagctgaggctcaagccctgagacgagagcaa
gaagcccggcagcgacagctcatgcatgagcgtctgtttgggcacagtagcacctccgca
ctctctgctattctccgaagcccggctttcaccagtcgcttaagtggcaaccgtggggtc
cagtatactcgccttgctgtgcagagaggtggcaccttccagatggggggtagcagcagc
cataacaggccttctggcagtaatgtagatactctcctccgcctccgaggacggctcctt
ctggaccacgaagccctttcttgtctcttggtcctactttttgtggatgagccaaagctc
aatactagccgtctacaccgagtactgagaaatctctgctaccatgcccagacccgccac
tgggtcatccgcagtctgctctccatcttgcagcgcagcagtgagagtgagctatgcatt
gaaacacccaaactcactacaagtgaggaaaagggcaaaaagtcgagcaagagctgtggg
tcaagtagccatgagaaccgtcccctggacctgctacacaagatggagtcaaagagctcc
aaccagctttcctggctctcagtatccatggatgcagccctaggctgcaggactaatata
tttcagatccagcgttcaggggggcgtaaacataccgagaagcatgcaagcggtggctcc
accgtccacatccatccccaagctgctcctgttgtctgcagacacgttttggatacactc
attcaattggccaaggtatttcccagccacttcacacagcagcggaccaaagaaacaaac
tgtgagagtgatcgggaaaggggcaataaggcctgtagcccatgctcctcacagtcctcc
agcagtggcatttgcacagacttctgggacttattggtaaaactggacaacatgaatgtc
agccggaaaggcaagaactccgtgaagtcagtgccagtgagcgctggcggtgagggggaa
acctctccatacagcctcgaggcctctccactggggcagctcatgaacatgttgtcacac
ccagtcatccgccggagctctctcttaactgagaaactcctcagactcctttctctcatc
tcaattgctctcccagaaaacaaggtgtcagaagcacaggctaattctggcagcggtgct
tcctccaccaccactgccacctcaaccacatctaccaccaccaccactgccgcctccacc
acgcccacaccccctactgcacccacccctgtcacttctgctccagccctggttgctgcc
acggctatttccaccattgtcgtagctgcttcgaccacagtgactacccccacgactgct
accactactgtttcaatttctcccactactaagggcagcaaatctccagcgaaggtgagt
gatgggggcagcagcagtacagactttaagatggtgtcctctggcctcactgaaaaccag
ctacagctctctgtagaggtgttgacatcccactcttgttctgaggaaggcttagaggat
gcagccaacgtactactgcagctctcccggggggactctgggacccgggacactgttctc
aagctgctactgaatggagcccgccatctgggttataccctttgtaaacaaataggtacc
ctgctggccgagctgcgggaatacaacctcgagcagcagcggcgagcccaatgtgaaacc
ctctctcctgatggcctgcctgaggagcagccacagaccaccaagctgaagggcaaaatg
cagagcaggtttgacatggctgagaatgtggtaattgtggcatctcagaagcgacctttg
ggtggccgggagctccagctgccttctatgtccatgttgacatccaagacatctacccag
aagttcttcttgagggtactacaggtcatcatccagctccgggacgacacgcgccgggct
aacaagaaagccaagcagacaggcaggctaggttcctccggtttaggctcagctagcagc
atccaggcagctgttcggcagctggaggctgaggctgatgccattatacaaatggtacgt
gagggtcaaagggcgcggagacagcaacaagcagcaacgtcggagtctagccagtcagag
gcgtctgtccggagggaggaatcacccatggatgtggaccagccatctcccagtgctcaa
gatactcaatccattgcctccgatggaaccccacagggggagaaggaaaaggaagaaaga
ccacctgagttacccctgctcagcgagcagctgagtttggacgagctgtgggacatgctt
ggggagtgtctaaaggaactagaggaatcccatgaccagcatgcggtgctagtgctacag
cctgctgtcgaggccttctttctggtccatgccacagagcgggagagcaagcctcctgtc
cgagacacccgtgagagccagctggcacacatcaaggacgagcctcctccactctcccct
gcccccttaaccccagccacgccttcctcccttgacccattcttctcccgggagccctca
tctatgcacatctcctcaagcctgccccctgacacacagaagttccttcgctttgcagag
actcaccgcactgtgttaaaccagatcctacggcagtccacgacccaccttgctgatggg
ccttttgctgtcctggtagactacattcgtgtcctcgactttgatgtcaagcgcaaatat
ttccgccaagagctggagcgtttagatgaggggctccggaaagaagacatggctgtgcat
gtccgtcgtgaccatgtgtttgaagactcctatcgtgagctgcatcgcaaatcccccgaa
gaaatgaagaatcgattgtatatagtatttgaaggagaagaagggcaggatgctggtggg
ctcctgcgggagtggtatatgatcatctctcgagagatgtttaaccctatgtatgccttg
ttccgtacctcacctggtgatcgagtcacctacaccatcaatccatcttcccactgcaac
cccaaccacctcagctacttcaagtttgtcggacgcattgtggccaaagctgtatatgac
aaccgtcttctggagtgctactttactcgatccttttacaaacacatcttgggcaagtca
gtcagatatacagatatggagagtgaagattaccacttctaccaaggtctggtttatctg
ctggaaaatgatgtctccacactaggctatgacctcaccttcagcactgaggtccaagag
tttggagtttgtgaagttcgtgacctcaaacccaatggggccaacatcttggtaacagag
gagaataagaaggagtatgtacacctggtatgccagatgagaatgacaggagccatccgc
aagcagttggcggctttcttagaaggcttctatgagatcattccaaagcgcctcatttcc
atcttcactgagcaggagttagagctgcttatatcaggactgcccaccattgacatcgat
gatctgaaatccaacactgaataccacaagtaccagtccaactctattcagatccagtgg
ttctggagagcattgcgttctttcgatcaagctgaccgtgccaagttcctccagtttgtc
acaggtacttccaaggtacccctgcaaggctttgctgccctcgaaggcatgaatggcatt
cagaagtttcagatccatcgagatgacaggtccacagatcgcctgccttcagctcacaca
tgttttaatcagctggatctgcctgcctatgagagctttgagaagctccgccacatgcta
ctgttggctatccaggagtgctctgaaggctttgggctggcctaa

DBGET integrated database retrieval system