KEGG   Homo sapiens (human): 10079
Entry
10079             CDS       T01001                                 

Gene name
ATP9A, ATPIIA
Definition
(RefSeq) ATPase phospholipid transporting 9A (putative)
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    10079 (ATP9A)
Enzymes [BR:hsa01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     10079 (ATP9A)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Hydrolase E1-E2_ATPase Cation_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 10079
NCBI-ProteinID: NP_006036
OMIM: 609126
HGNC: 13540
Ensembl: ENSG00000054793
Vega: OTTHUMG00000032751
Pharos: O75110(Tdark)
UniProt: O75110 Q2NLD0 B4DR18
Position
20q13.2
AA seq 1047 aa
MTDNIPLQPVRQKKRMDSRPRAGCCEWLRCCGGGEARPRTVWLGHPEKRDQRYPRNVINN
QKYNFFTFLPGVLFNQFKYFFNLYFLLLACSQFVPEMRLGALYTYWVPLGFVLAVTVIRE
AVEEIRCYVRDKEVNSQVYSRLTARGTVKVKSSNIQVGDLIIVEKNQRVPADMIFLRTSE
KNGSCFLRTDQLDGETDWKLRLPVACTQRLPTAADLLQIRSYVYAEEPNIDIHNFVGTFT
REDSDPPISESLSIENTLWAGTVVASGTVVGVVLYTGRELRSVMNTSNPRSKIGLFDLEV
NCLTKILFGALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPISLRVNLDMGKIVYSW
VIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMIFKRLHLGTVAYGLDSMDE
VQSHIFSIYTQQSQDPPAQKGPTLTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTD
QAEAEKQYEDSCRVYQASSPDEVALVQWTESVGLTLVGRDQSSMQLRTPGDQILNFTILQ
IFPFTYESKRMGIIVRDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLV
VAKKSLAEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVR
PTLETLRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDIHVFRLVTNRGEAHLELNAFR
RKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLT
CAVGDGGNDVSMIQESDCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSA
ALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKS
EVAMLYPELYKDLLKGRPLSYKTFLIWVLISIYQGSTIMYGALLLFESEFVHIVAISFTS
LILTELLMVALTIQTWHWLMTVAELLSLACYIASLVFLHEFIDVYFIATLSFLWKVSVIT
LVSCLPLYVLKYLRRRFSPPSYSKLTS
NT seq 3144 nt   +upstreamnt  +downstreamnt
atgacggacaacatcccgctgcagccggtgcgccagaagaagcggatggacagcaggccc
cgcgccgggtgctgcgagtggctgagatgctgcggtggaggggaggccaggccccgcact
gtctggctggggcaccccgagaagagagaccagaggtatcctcggaatgtcatcaacaat
cagaagtacaatttcttcacctttcttcctggggtgctgttcaaccagttcaaatacttt
ttcaacctctatttcttacttcttgcctgctctcagtttgttcccgaaatgagacttggt
gcactctatacctactgggttcccctgggcttcgtgctggccgtcactgtcatccgtgag
gcggtggaggagatccgatgctacgtgcgggacaaggaagtcaactcccaggtctacagc
cggctcacagcacgaggcacagtgaaggtgaagagttctaacatccaagttggagacctt
atcatcgttgaaaagaaccagcgggtccctgccgacatgatcttcctgaggacatcagaa
aaaaacgggtcatgcttcttgcggacggatcagctggatggggagacggactggaagctg
cggcttcccgtggcctgcacgcagaggctccccacggccgccgaccttcttcagattcga
tcgtatgtgtacgcagaagagccaaatattgacattcacaacttcgtgggaacttttacc
cgagaagacagcgaccccccgatcagcgagagcctgagcatagagaacacgctgtgggct
ggcactgtggtcgcatcaggtactgttgtgggtgttgttctttacactggcagagaactc
cggagtgtcatgaatacctcaaatccccgaagtaagatcggcctgttcgacttggaagtg
aactgcctcaccaagatcctctttggtgccctggtggtggtctcgctggtcatggttgcc
cttcagcactttgcaggccgttggtacctgcagatcatccgcttcctcctcttgttttcc
aacatcatccccattagtttgcgtgtgaacctggacatgggcaagatcgtgtacagctgg
gtgattcgaagggactcgaaaatccccgggaccgtggttcgctccagcacgattcctgag
cagctgggcaggatttcgtacttactcacagacaagacaggcactcttacccagaacgag
atgattttcaaacggctccatctcggaacagtagcctacggcctcgactcaatggacgaa
gtacaaagccacattttcagcatttacacccagcaatcccaggacccaccggctcagaag
ggcccaacgctcaccactaaggtccggcggaccatgagcagccgcgtgcacgaagccgtg
aaggccatcgcgctctgccacaacgtgactcccgtgtatgagtccaacggtgtgactgat
caggctgaggccgagaagcagtacgaagactcctgccgcgtataccaggcatccagcccc
gatgaggtggccctggtacagtggacggaaagtgtgggcttaaccctggtgggccgagac
cagtcttccatgcagctgaggacccctggcgaccagatcctgaacttcaccatcctacag
atcttccctttcacctatgaaagcaaacgtatgggcatcatcgtgcgggatgaatcaact
ggagaaattacgttttacatgaagggagcagatgtggtcatggctggcattgtgcagtac
aatgactggttggaggaagagtgtggcaacatggcccgagaagggctgcgggtgctcgtg
gtggcaaagaagtctcttgcagaggagcagtatcaggactttgaagcccgctacgtccag
gccaagctgagtgtgcacgaccgctccctcaaagtggccacggtgatcgagagcctggag
atggagatggaactgctgtgcctgacgggcgtggaggaccagctgcaggcagatgtgcgg
cccacgctggagaccctgaggaatgctggcatcaaggtttggatgctgacaggggacaag
ctggagacagctacgtgcacagcgaagaatgcacatctggtgaccagaaaccaagacatc
cacgtttttcggctggtgaccaaccgcggggaggctcacctcgagctgaacgccttccgc
aggaagcatgattgtgccctggtcatctcgggagactccctggaggtttgcctcaagtac
tatgagtacgagttcatggagctggcctgccagtgcccggccgtagtctgctgccgatgt
gcccccacccagaaggcccagatcgtgcgcctgcttcaggagcgcacgggcaagctcacc
tgtgcagtaggggacggaggcaatgacgtcagcatgattcaggaatctgactgcggcgtg
ggagtggaaggaaaggaaggaaaacaggcttcgttggctgcagacttctccatcactcaa
tttaagcatcttggccggttgcttatggtgcatggccggaacagctacaagcggtcagcc
gccctcagccagttcgtgattcacaggagcctctgtatcagcaccatgcaggctgtcttt
tcctccgtgttttactttgcctccgtccctctctatcaaggattcctcatcattgggtac
tccacaatttacaccatgtttcctgtgttttctctggtcctggacaaagatgtcaaatcg
gaagttgccatgctgtatcctgagctctacaaggatcttctcaagggacggccgttgtcc
tacaagacattcttaatatgggttttgattagcatctatcaagggagcaccatcatgtac
ggggcgctgctgctgtttgagtcggagttcgtgcacatcgtggccatctccttcacctcg
ctgatcctcaccgagctgctcatggtggcgctgaccatccagacctggcactggctcatg
acagtggcggagctgctcagcctggcctgctacatcgcctccctggtgttcttacacgag
ttcatcgatgtgtacttcatcgccaccttgtcattcttgtggaaagtctccgtcatcact
ctggtcagctgcctccccctctatgtcctcaagtacctgcgaagacggttctctcccccc
agctactcaaagctcacatcatag

DBGET integrated database retrieval system