KEGG   Homo sapiens (human): 10082Help
Entry
10082             CDS       T01001                                 

Gene name
GPC6, OMIMD1
Definition
(RefSeq) glypican 6
  KO
K08112  glypican 6
Organism
hsa  Homo sapiens (human)
Disease
H00493  Heparan sulfate proteoglycan gene defects
H02154  Omodysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    10082 (GPC6)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    10082 (GPC6)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   10082 (GPC6)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  10082 (GPC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican DUF1910
Motif
Other DBs
NCBI-GeneID: 10082
NCBI-ProteinID: NP_005699
OMIM: 604404
HGNC: 4454
Ensembl: ENSG00000183098
Vega: OTTHUMG00000017205
Pharos: Q9Y625(Tbio)
UniProt: Q9Y625
Position
13q31.3-q32.1
AA seq 555 aa AA seqDB search
MPSWIGAVILPLLGLLLSLPAGADVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRIC
PQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSL
NDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQY
HFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSP
TPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAE
RLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENF
NTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEE
ECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNG
NDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDSSAAQRGHSLLS
WSLTCIVLALQRLCR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttggatcggggctgtgattcttcccctcttggggctgctgctctccctcccc
gccggggcggatgtgaaggctcggagctgcggagaggtccgccaggcgtacggtgccaag
ggattcagcctggcggacatcccctaccaggagatcgcaggggaacacttaagaatctgt
cctcaggaatatacatgctgcaccacagaaatggaagacaagttaagccaacaaagcaaa
ctcgaatttgaaaaccttgtggaagagacaagccattttgtgcgcaccacttttgtgtcc
aggcataagaaatttgacgaatttttccgagagctcctggagaatgcagaaaagtcacta
aatgatatgtttgtacggacctatggcatgctgtacatgcagaattcagaagtcttccag
gacctcttcacagagctgaaaaggtactacactgggggtaatgtgaatctggaggaaatg
ctcaatgacttttgggctcggctcctggaacggatgtttcagctgataaaccctcagtat
cacttcagtgaagactacctggaatgtgtgagcaaatacactgaccagctcaagccattt
ggagacgtgccccggaaactgaagattcaggttacccgcgccttcattgctgccaggacc
tttgtccaggggctgactgtgggcagagaagttgcaaaccgagtttccaaggtcagccca
accccagggtgtatccgtgccctcatgaagatgctgtactgcccatactgtcgggggctt
cccactgtgaggccctgcaacaactactgtctcaacgtcatgaagggctgcttggcaaat
caggctgacctcgacacagagtggaatctgtttatagatgcaatgctcttggtggcagag
cgactggaggggccattcaacattgagtcggtcatggacccgatagatgtcaagatttct
gaagccattatgaacatgcaagaaaacagcatgcaggtgtctgcaaaggtctttcaggga
tgtggtcagcccaaacctgctccagccctcagatctgcccgctcagctcctgaaaatttt
aatacacgtttcaggccctacaatcctgaggaaagaccaacaactgctgcaggcacaagc
ttggaccggctggtcacagacataaaagagaaattgaagctctctaaaaaggtctggtca
gcattaccctacactatctgcaaggacgagagcgtgacagcgggcacgtccaacgaggag
gaatgctggaacgggcacagcaaagccagatacttgcctgagatcatgaatgatgggctc
accaaccagatcaacaatcccgaggtggatgtggacatcactcggcctgacactttcatc
agacagcagattatggctctccgtgtgatgaccaacaaactaaaaaacgcctacaatggc
aatgatgtcaatttccaggacacaagtgatgaatccagtggctcagggagtggcagtggg
tgcatggatgacgtgtgtcccacggagtttgagtttgtcaccacagaggcccccgcagtg
gatcccgaccggagagaggtggactcttctgcagcccagcgtggccactccctgctctcc
tggtctctcacctgcattgtcctggcactgcagagactgtgcagataa

DBGET integrated database retrieval system