KEGG   Homo sapiens (human): 10087Help
Entry
10087             CDS       T01001                                 

Gene name
COL4A3BP, CERT, CERTL, GPBP, MRD34, STARD11
Definition
(RefSeq) collagen type IV alpha 3 binding protein
  KO
K08283  collagen type IV alpha-3-binding protein
Organism
hsa  Homo sapiens (human)
Disease
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    10087 (COL4A3BP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: START PH PH_8 PH_11 Acyl_CoA_thio
Motif
Other DBs
NCBI-GeneID: 10087
NCBI-ProteinID: NP_005704
OMIM: 604677
HGNC: 2205
Ensembl: ENSG00000113163
Vega: OTTHUMG00000102068
Pharos: Q9Y5P4(Tbio)
UniProt: Q9Y5P4
Structure
PDB: 

Position
5q13.3
AA seq 624 aa AA seqDB search
MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDE
TEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESG
YGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQK
YFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHSTNGNKEKLFPHVTPKGINGID
FKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYKNAMTELKK
KSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSLPSGDAFS
SVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDVGGDANWQL
VVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHV
VETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPL
NNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKR
EYPKFLKRFTSYVQEKTAGKPILF
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataatcagagctggaactcgtcgggctcggaggaggatccagagacggagtct
gggccgcctgtggagcgctgcggggtcctcagtaagtggacaaactacattcatgggtgg
caggatcgttgggtagttttgaaaaataatgctctgagttactacaaatctgaagatgaa
acagagtatggctgcagaggatccatctgtcttagcaaggctgtcatcacacctcacgat
tttgatgaatgtcgatttgatattagtgtaaatgatagtgtttggtatcttcgtgctcag
gatccagatcatagacagcaatggatagatgccattgaacagcacaagactgaatctgga
tatggatctgaatccagcttgcgtcgacatggctcaatggtgtccctggtgtctggagca
agtggctactctgcaacatccacctcttcattcaagaaaggccacagtttacgtgagaag
ttggctgaaatggaaacatttagagacatcttatgtagacaagttgacacgctacagaag
tactttgatgcctgtgctgatgctgtctctaaggatgaacttcaaagggataaagtggta
gaagatgatgaagatgactttcctacaacgcgttctgatggtgacttcttgcatagtacc
aacggcaataaagaaaagttatttccacatgtgacaccaaaaggaattaatggtatagac
tttaaaggggaagcgataacttttaaagcaactactgctggaatccttgcaacactttct
cattgtattgaactaatggttaaacgtgaggacagctggcagaagagactggataaggaa
actgagaagaaaagaagaacagaggaagcatataaaaatgcaatgacagaacttaagaaa
aaatcccactttggaggaccagattatgaagaaggccctaacagtctgattaatgaagaa
gagttctttgatgctgttgaagctgctcttgacagacaagataaaatagaagaacagtca
cagagtgaaaaggtgagattacattggcctacatccttgccctctggagatgccttttct
tctgtggggacacatagatttgtccaaaagccctatagtcgctcttcctccatgtcttcc
attgatctagtcagtgcctctgatgatgttcacagattcagctcccaggttgaagagatg
gtgcagaaccacatgacttactcattacaggatgtaggcggagatgccaattggcagttg
gttgtagaagaaggagaaatgaaggtatacagaagagaagtagaagaaaatgggattgtt
ctggatcctttaaaagctacccatgcagttaaaggcgtcacaggacatgaagtctgcaat
tatttctggaatgttgacgttcgcaatgactgggaaacaactatagaaaactttcatgtg
gtggaaacattagctgataatgcaatcatcatttatcaaacacacaagagggtgtggcct
gcttctcagcgagacgtattatatctttctgtcattcgaaagataccagccttgactgaa
aatgaccctgaaacttggatagtttgtaatttttctgtggatcatgacagtgctcctcta
aacaaccgatgtgtccgtgccaaaataaatgttgctatgatttgtcaaaccttggtaagc
ccaccagagggaaaccaggaaattagcagggacaacattctatgcaagattacatatgta
gctaatgtgaaccctggaggatgggcaccagcctcagtgttaagggcagtggcaaagcga
gagtatcctaaatttctaaaacgttttacttcttacgtccaagaaaaaactgcaggaaag
cctattttgttctag

DBGET integrated database retrieval system