KEGG   Homo sapiens (human): 10090
Entry
10090             CDS       T01001                                 

Gene name
UST, 2OST
Definition
(RefSeq) uronyl 2-sulfotransferase
  KO
K03193  dermatan/chondrotin sulfate uronyl 2-O-sulfotransferase UST [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    10090 (UST)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    10090 (UST)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     10090 (UST)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   10090 (UST)
SSDB
Motif
Pfam: Sulfotransfer_2 Gal-3-0_sulfotr
Other DBs
NCBI-GeneID: 10090
NCBI-ProteinID: NP_005706
OMIM: 610752
HGNC: 17223
Ensembl: ENSG00000111962
Vega: OTTHUMG00000016135
Pharos: Q9Y2C2(Tbio)
UniProt: Q9Y2C2
Position
6q25.1
AA seq 406 aa
MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCL
GSLLYQLSGGPPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL
LLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGD
QPVYINIIRDPVNRFLSNYFFRRFGDWRGEQNHMIRTPSMRQEERYLDINECILENYPEC
SNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLLVGILEELEDVLLLLERFLPH
YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHYVKEQFHLLKR
KFGLKSHVSKPPLRPHFFIPTPLETEEPIDDEEQDDEKWLEDIYKR
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgaagaagaagcagcagcatcccggcggcggcgcggatccctggccccatggggcccct
atggggggcgcccctccgggcctgggcagctggaagcgtcgggtgcccctgctgcctttc
ctgcgcttctccctccgggactacggcttctgcatggccaccctgctggtcttctgcctg
ggctccctcctctatcagctcagcgggggaccccctcgcttcctgctcgacctgcggcag
tacttgggaaattccacttacttggatgaccatggaccacctcctagtaaggtactacct
ttcccaagccaggtggtgtacaacagggtaggcaagtgtgggagccgtactgtggtcttg
cttctgagaatcttgtcggagaagcacggatttaatttggtcacatcagacattcacaac
aaaaccaggcttactaaaaatgaacaaatggaactgattaaaaatataagtactgccgaa
caaccctatttattcactcgacatgttcatttcctcaacttctcaaggtttggaggagac
cagcctgtctacatcaacatcattagagaccccgtcaaccggttcttatccaactatttt
ttccgtcgctttggagactggagaggggaacaaaatcacatgatccgcacccccagcatg
aggcaggaggagcgctacctggatatcaatgagtgtattcttgaaaactatcccgagtgc
tccaaccccaggttattttacatcattccgtacttttgtggacagcatcccagatgcagg
gagcctggtgaatgggcccttgagagagcaaagctgaacgtgaatgaaaacttcctgctc
gtggggattcttgaagagttggaagatgtgctgctgttactggaaagatttttacctcat
tacttcaagggcgtgctcagtatctacaaagacccagagcacaggaagcttggaaacatg
actgtgacggtgaagaagactgtcccctctcctgaggctgtgcagatcctctaccagcgg
atgagatacgagtacgagttttaccactacgtcaaagagcagttccacctgctgaagcgc
aagtttggacttaagtctcacgtcagcaagccccccctgaggccacacttctttatccca
actccactggaaaccgaggagccaatcgacgatgaagaacaggatgatgaaaagtggctg
gaagatatttataagaggtga

DBGET integrated database retrieval system