KEGG   Homo sapiens (human): 10097Help
Entry
10097             CDS       T01001                                 

Gene name
ACTR2, ARP2
Definition
(RefSeq) actin related protein 2
  KO
K17260  actin-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    10097 (ACTR2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    10097 (ACTR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10097 (ACTR2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10097 (ACTR2)
   04147 Exosome [BR:hsa04147]
    10097 (ACTR2)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10097 (ACTR2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10097 (ACTR2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10097 (ACTR2)
  Exosomal proteins of other body fluids (saliva and urine)
   10097 (ACTR2)
  Exosomal proteins of bladder cancer cells
   10097 (ACTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 10097
NCBI-ProteinID: NP_005713
OMIM: 604221
HGNC: 169
Ensembl: ENSG00000138071
Vega: OTTHUMG00000129540
Pharos: P61160(Tbio)
UniProt: P61160
Position
2p14
AA seq 394 aa AA seqDB search
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE
ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR
EKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTR
RLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL
VESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAV
LADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagggcaggaaggtggtggtgtgcgacaacggcaccgggtttgtgaagtgt
ggatatgcaggctctaactttccagaacacatcttcccagctttggttggaagacctatt
atcagatcaaccaccaaagtgggaaacattgaaatcaaggatcttatggttggtgatgag
gcaagtgaattacgatcaatgttagaagttaactaccctatggaaaatggcatagtacga
aattgggatgacatgaaacacctgtgggactacacatttggaccagagaaacttaatata
gataccagaaattgtaaaatcttactcacagaacctcctatgaacccaaccaaaaacaga
gagaagattgtagaggtaatgtttgaaacttaccagttttccggtgtatatgtagccatc
caggcagttctgactttgtacgctcaaggtttattgactggtgtagtggtagactctgga
gatggtgtgactcacatttgcccagtatatgaaggcttttctctccctcatcttaccagg
agactggatattgctgggagggatataactagatatcttatcaagctacttctgttgcga
ggatacgccttcaaccactctgctgattttgaaacggttcgcatgattaaagaaaaactg
tgttacgtgggatataatattgagcaagagcagaaactggccttagaaaccacagtatta
gttgaatcttatacactcccagatggacgtatcatcaaagttgggggagagagatttgaa
gcaccagaagctttatttcagcctcacttgatcaatgttgaaggagttggtgttgctgaa
ttgctttttaacacaattcaggcagctgacattgataccagatctgaattctacaaacac
attgtgctttctggagggtctactatgtatcctggcctgccatcacggttggaacgagaa
cttaaacagctttacttagaacgagttttgaagggtgatgtggaaaaactttctaaattt
aagatccgcattgaagacccaccccgcagaaagcacatggtattcctgggtggtgcagtt
ctagcggatatcatgaaagacaaagacaacttttggatgacccgacaagagtaccaagaa
aagggtgtccgtgtgctagagaaacttggtgtgactgttcgataa

DBGET integrated database retrieval system