KEGG   Homo sapiens (human): 10099Help
Entry
10099             CDS       T01001                                 

Gene name
TSPAN3, TM4-A, TM4SF8, TSPAN-3
Definition
(RefSeq) tetraspanin 3
  KO
K17293  tetraspanin-3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10099 (TSPAN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   10099 (TSPAN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin Phage_holin_3_6
Motif
Other DBs
NCBI-GeneID: 10099
NCBI-ProteinID: NP_005715
OMIM: 613134
HGNC: 17752
Ensembl: ENSG00000140391
Vega: OTTHUMG00000143728
Pharos: O60637(Tdark)
UniProt: O60637
Position
15q24.3
AA seq 253 aa AA seqDB search
MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLIPAVVIIAV
GALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQ
KVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETAS
NCNGSLAHPSDLYAEGCEALVVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRD
PAYELLITGGTYA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggccagtgcggcatcacctcctccaagaccgtgctggtctttctcaacctcatcttc
tggggggcagctggcattttatgctatgtgggagcctatgtcttcatcacttatgatgac
tatgaccacttctttgaagatgtgtacacgctcatccctgctgtagtgatcatagctgta
ggagccctgcttttcatcattgggctaattggctgctgtgccacaatccgggaaagtcgc
tgtggacttgccacgtttgtcatcatcctgctcttggtttttgtcacagaagttgttgta
gtggttttgggatatgtttacagagcaaaggtggaaaatgaggttgatcgcagcattcag
aaagtgtataagacctacaatggaaccaaccctgatgctgctagccgggctattgattat
gtacagagacagctgcattgttgtggaattcacaactactcagactgggaaaatacagat
tggttcaaagaaaccaaaaaccagagtgtccctcttagctgctgcagagagactgccagc
aattgtaatggcagcctggcccacccttccgacctctatgctgaggggtgtgaggctcta
gtagtgaagaagctacaagaaatcatgatgcatgtgatctgggccgcactggcatttgca
gctattcagctgctgggcatgctgtgtgcttgcatcgtgttgtgcagaaggagtagagat
cctgcttacgagctcctcatcactggcggaacctatgcatag

DBGET integrated database retrieval system