KEGG   Homo sapiens (human): 100996331Help
Entry
100996331         CDS       T01001                                 

Gene name
POTEB, A26B1, CT104.5, POTE-15, POTE15, POTEB2
Definition
(RefSeq) POTE ankyrin domain family member B
  KO
K17299  POTE ankyrin domain family protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    100996331 (POTEB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100996331 (POTEB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3 CCDC144C
Motif
Other DBs
NCBI-GeneID: 100996331
NCBI-ProteinID: NP_001264233
OMIM: 608912
HGNC: 33734
Ensembl: ENSG00000233917
Vega: OTTHUMG00000171734
Pharos: H3BUK9(Tdark)
UniProt: H3BUK9 A0A0A6YYL3
Position
15q11.2
AA seq 544 aa AA seqDB search
MVAEVCSMPAASAVKKPFDLRSKMGKWCHHRFPCCRGSGTSNVGTSGDHDDSFMKTLRSK
MGKWCCHCFPCCRGSGKSNVGTWGDYDDSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDL
IVMLRDTDMNKRDKQKRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAVQCQ
EDECVLMLLEHGADGNIQDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLL
LGVHEQKQEVVKFLIKKKANLNALDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLS
GQTAREYAVSSHHHVICELLSDYKEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQ
PEKMSQEPEINKDCDREVEEEIKKHGSNPVGLPENLTNGASAGNGDDGLIPQRKSRKPEN
QQFPDTENEEYHSDEQNDTQKQLSEEQNTGISQDEILTNKQKQIEVAEKEMNSELSLSHK
KEEDLLRENSMLREEIAKLRLELDETKHQNQLRENKILEEIESVKEKLLKTIQLNEEALT
KTSI
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggtggctgaggtttgttcaatgcccgctgcctctgctgtgaagaagccatttgatctc
aggagcaagatgggcaagtggtgccaccaccgcttcccctgctgcagggggagcggcacg
agcaatgtgggcacttctggagaccatgacgactcctttatgaagacactcaggagcaag
atgggcaagtggtgctgtcactgcttcccctgctgcagggggagcggcaagagcaacgtg
ggcacttggggagactacgacgacagcgccttcatggagccgaggtaccacgtccgtcga
gaagatctggacaagctccacagagctgcctggtggggtaaagtccccagaaaggatctc
atcgtcatgctcagggacactgacatgaacaagagggacaagcaaaagaggactgctcta
catttggcctctgccaatggaaattcagaagtagtacaactcctgctggacagacgatgt
caacttaacgtccttgacaacaaaaaaaggacagctctgataaaggccgtacaatgccag
gaagatgaatgtgtgttaatgttgctggaacatggcgctgatggaaatattcaagatgag
tatggaaataccgctctacactatgctatctacaatgaagataaattaatggccaaagca
ctgctcttatatggtgctgatattgaatcaaaaaacaagtgtggcctcacaccacttttg
cttggcgtacatgaacaaaaacaggaagtggtgaaatttttaatcaagaaaaaagctaat
ttaaatgcacttgatagatatggaagaactgccctcatacttgctgtatgttgtggatca
gcaagtatagtcaatcttctacttgagcaaaatgttgatgtatcttctcaagatctatct
ggacagacagccagagagtatgctgtttctagtcatcatcatgtaatttgtgaattactt
tctgactataaagaaaaacagatgctaaaaatctcttctgaaaacagcaatccagaacaa
gacttaaagctgacatcagaggaagagtcacaaaggcttaaagtcagtgaaaatagccag
ccagagaaaatgtctcaagaaccagaaataaataaggactgtgatagagaggttgaagaa
gaaataaagaagcatggaagtaatcctgtgggattaccagaaaacctgactaatggtgcc
agtgctggcaatggtgatgatggattaattccacaaaggaagagcagaaaacctgaaaat
cagcaatttcctgacactgagaatgaagagtatcacagtgacgaacaaaatgatacccag
aaacaactttctgaagaacagaacactggaatatcacaagatgagattctgactaataaa
caaaagcagatagaagtggctgaaaaggaaatgaattctgagctttctcttagtcataag
aaagaagaagatctcttgcgtgaaaacagcatgttgcgggaagaaattgccaagctaaga
ctggaactagatgaaacaaaacatcagaaccagctaagggaaaataaaattttggaggaa
attgaaagtgtaaaagaaaaacttctaaagactatacaactgaatgaagaagcattaacg
aaaaccagtatttaa

DBGET integrated database retrieval system